02 Temmuz 2019 Salı düşen domain (alan adı) listelerini yazımızın devamında bulabilirsiniz.

Domainlerin düşeceği gün, en geç saat 17.00-18.00 saat aralığında günün listesi sitemize eklenmektedir.

Facebook’ta Takip Et, Listeler Eklendikçe Haberin Olsun: https://www.facebook.com/isimyakala/


Domainler Ne Zaman Saat Kaçta Düşecekler?

Alan adıları yıllık olarak satın alınmaktadır ve eski sahipleri tarafından yenilenmediklerinde boşa düşerek tekrar satın alınabilir hale gelirler.

Farklı uzantılara sahip alan adlarının bugün akşam hangi saat araşığında düşeceğini linkteki yazımızda görebilirsiniz. En çok takip edilen .COM ve .NET uzantılar akşamları saat 20.30’dan sonra düşmeye başlamaktadır. Aşağıdaki listelerdeki alan adları bugün akşam düşecektir henüz düşmemiştir ! Detaylı bilgi için: Domainler Ne Zaman Boşa Düşer

02 Temmuz Bugün Düşecek Alan Adları

Aşağıda kategorilere göre ayrılmış alan adlarının bir kısmını görebilirsiniz. Bugün sizler için seçtiğimiz alan adının tam listesini yazımızın alt bölümlerindeki tablomuzda görebilirsiniz.

Jenerik domain önerileri;

Jenerik alan adları bölümünde TDK Sözlük anlamlı düşecek alan adları listelenmektedir.

adamca.org
belen.info
cine.tv
durust.net
duvar.net
efsane.info
fasil.info
forvet.org
getto.info
hazircevap.org
heyecan.info
hosca.org
imge.net
kadinkadina.org
kalendermesrep.com
kalinma.com
kani.info
lakerdaci.com
lejyon.net
mecmu.com
milyoner.info
pikap.info
rahatrahat.com
rayic.org
rezene.info
rutin.org
satranc.org
satvet.com
sivilsavunma.org
sonderece.com
sosyetepazari.org
tekme.net
torpilsiz.com
uzlastirici.org
vasif.net

02 Temmuz Düşecek Domainler Listesi

Aşağıdaki listedeki bul kısmına bilgi, sağlık, araba, haber, tekno, ekonomi, kadin, indir, tatil, emlak, bilet, kripto, sohbet, yemek, bebek, kitap, hediye, moda, oyun, sigorta, kredi, indir gibi kelimeleri yazarak sadece o kelimenin geçtiği alan adlarını görebilirsiniz.




DomainUzantıUzunlukBacklinkArchiveSon KayıtToplam Kayıt
altinoyun.comcom91124220180
dervisogluemlak.comcom15385820171
kumrusohbet.comcom111106320180
teknoix.comcom722120170
teknolutions.comcom1202220180
adanahaberci.comcom123613920131
forumbilgin.comcom1145520071
piernodoyuna.comcom12226120180
uzmanakupunktur.comcom1512220090
oyunpaketi.comcom10210120180
siranemlak.comcom1001220140
kayseriemlakofisi.comcom179149729720090
turkiyemsohbet.comcom1455132520180
tatilpa.comcom7557020180
aydogduemlak.comcom1213120180
divixindir.comcom100320180
ksteknoloji.comcom113220180
kocemlak.netnet8131820094
ulubeyhaber.comcom1101120181
videohaber.netnet1004820184
onlinesigorta.netnet1306420094
bodrumarabakiralama.orgorg19283720092
facesohbet.orgorg10205620181
doyumsuzsohbet.comcom1415484020170
haberfanatik.comcom1246120100
tekno-san.comcom90020181
teknolojiorumcegi.comcom1761820090
kredikartiborcuodeme.comcom20187220180
adiguzelemlak.comcom1303020182
haberlerburda.comcom1313420181
hipersohbet.comcom1150917520180
techteknoloji.comcom13181720180
kartarabatowa.netnet130420183
oyunoynakazan.comcom1304120130
xaraba.comcom603320130
aydin09haber.comcom1201020170
sonucakbileti.comcom130120160
habersabah.comcom1052135420100
resitaltatil.comcom120620090
cevreteknoloji.comcom140220180
yukselenteknoloji.comcom170420180
haberamed.comcom90120110
kucukoyun.comcom903720180
saltanatemlak.comcom130620150
biletistanbul.comcom131593920140
teknolojidedestek.comcom1717428620120
tugrulemlak.comcom1103320171
kampusteknolojileri.comcom19455720140
indirimlihat.comcom122820180
taoyuntuan.comcom100520180
arababankasi.comcom1205920160
emrebilgic.comcom100320160
gulersohbet.comcom1111520170
dergahhaber.comcom1101120100
taoyungao.comcom901020180
avrupahaberleri.comcom1502620180
aktifsohbet.netnet1101320171
turbantatilkoyu.comcom1511420180
dizihaber.orgorg9184720177
teknolojibak.comcom1201620180
teknogirisimdernegi.orgorg1912420110
ankarabayanlari.comcom1596420170
bilgicagiegitim.comcom150720180
turkiyegundemhaber.comcom180520180
kannahediyelik.comcom1421620140
hisaremlaktorbali.comcom1701420160
bilgicgayrimenkul.comcom170020181
bodrumgunduzemlak.comcom1701220180
bilettut.comcom80120171
iddaabiletleri.comcom1401920180
ondokuzhaber.comcom120620180
1tiklayemek.comcom110020150
paoyunge.comcom80020180
sonsayfahaber.comcom1310264420180
jininghaoyun.comcom120020180
indirapeci.comcom100920140
sanalsigortam.comcom130120160
haoyun166.comcom90020180
gelinlikmagaza.comcom140020180
teknohat.netnet80020161
mutluemlakduzce.comcom1501620160
teknojump.comcom94620120
ankarahaber.orgorg1102320067
kitapbudur.orgorg100620132
basboyunkanserleri.comcom1831120140
diyarbakirhavalimaniarabakiralama.comcom330120140
emintatil.comcom90120180
guzidekardesleremlak.comcom203220150
hataymozaikhaber.comcom1632920130
jjhaoyunlai.comcom110020180
kanaldhaberler.comcom141332820180
konakemlaksilifke.comcom170020180
lehangarabananes.comcom160720070
makitaprostore.comcom140120120
muratakmansigorta.comcom173320181
gaspakemlak.comcom11441820160
anneoyuncak.comcom110120160
264emlak.comcom801220160
arabadansor.comcom110020160
profesyoneloyun.comcom150020160
teknosimya.comcom100020160
ucuzasohbet.comcom110020160
oyuncutv.netnet80220181
haberast.comcom8182920180
teknostarbilisim.comcom160120170
egebestemlak.comcom120320182
altinsohbet.comcom1101620180
bilginevi.comcom90620170
bebeklereorganik.comcom160120170
teknopoker88.comcom120120170
akillimagazam.comcom130220170
ladesyemekatolyesi.comcom180220170
okulkitapcim.comcom120020170
oyunrail.comcom80220171
speroemlak.comcom100120170
tatilhevesi.comcom110120170
uzmansol.comcom80420170
saglikbilgihatti.comcom160120150
schlechteliebhaber.comcom180120130
posta-haber.netnet110820101
arababigian.netnet110020180
cagyapiemlak.comcom120020180
erdirilisemlak.comcom140020180
sakinsehiremlak.comcom150020180
turkanemlakyapidekorasyon.comcom250020180
furkanemlaksamsun.netnet170020180
kriptoparam.orgorg110020183
bilgisavunma.comcom123520180
dizifilmindirsene.comcom170120180
duruevyemekleri.comcom150020180
evimnetemlak.comcom120020180
idealbilgiler.comcom130020180
kredime.comcom712020180
milindira.comcom90020180
oyunhaberiniz.comcom130020181
oyunmuhabir.comcom111020180
sifirdokuzhaber.comcom150220180
teknoasli.comcom931020180
taraftarhaber.orgorg130020181
digital-yasamhediye.comcom190020180
purejoyunlimited.comcom160020180
sinarabadi-stainless.comcom200720180
wadahaber.comcom90020180
sadecesonhaber.netnet140020180
altinarmaemlak.comcom140020180
asyahaberleri.comcom130520180
bilginzuccaciye.comcom150020180
bursademiremlak.comcom150020180
enderemlak77.comcom120020180
haberondokuz.comcom121020180
habersaatleri.comcom130420180
ikizleremlakdikmen.comcom180020180
kestelnuremlak.comcom140020180
konumemlakinsaat.comcom160020180
mobilonhaber.comcom120020180
okulandkitap.comcom120020180
ozayemlaktorbali.comcom160020180
oztasemlakgayrimenkul.comcom210020180
rokayemekevi.comcom120020180
tatilezipla.comcom110020180
yapikredi-bireyselbankacilik.comcom280020180
kriptopay.netnet90020183
magazakiralama.netnet140020181
dodurgaemlak.orgorg120020182
uzlastiriciemlak.orgorg160020182
jianmoyun.netnet90020181
bebekidsroom.comcom120020180
xiaoyunchu.comcom100020180
sohbethanci.comcom110020180
altinsohbet.netnet110320180
sohbethanci.netnet110020180
teknonimo.comcom90020180
maliyeokulu.comcom1174820151
bilkainsaat.comcom11133120150
kombiciburada.comcom1302220140
metaluminyum.comcom1222320180
yunusdis.comcom8148114420090
tasucuport.comcom1022820080
panelsansip.comcom1101820160
kizilayortodonti.comcom1611120160
makinatasima.comcom1232320180
petektriko.comcom100120181
mesajsozleri.comcom12411220180
tasuculimani.comcom1264920080
boschbolgeservisi.comcom1703320161
orneksurucukursu.comcom1602520180
7kita.comcom501020182
froccer.comcom7424720170
arzyatirim.comcom100620180
egegida.netnet70620162
hayaldunyam.netnet1141120181
nefsim.netnet60520180
trkadin.netnet701320181
yuvacik.netnet72463720164
sifabul.netnet743220161
sinemagazin.netnet1133916320091
sezercik.netnet858620071
kunduram.netnet811120181
subcheck.netnet813320183
avusturyavizesi.netnet15201620183
ledmarketi.netnet100820181
flylounge.netnet90720188
opelcikma.netnet903220172
durust.netnet614020183
photoshopdersleri.orgorg1704120172
akyazibakkallarodasi.orgorg2044220060
m82.orgorg3042201822
satranc.orgorg734467200312
adamca.orgorg601720185
captaintsubasa.orgorg14296320188
bekirli.orgorg701320171
ejedi.orgorg50920184
9zk.orgorg301020185
sosyetepazari.orgorg1322220177
tekvalf.comcom741120160
forvet.orgorg6413420189
toplandik.comcom90820181
programsepeti.netnet13456420182
aracim.netnet612820182
bibakalim.comcom904620120
labordc.comcom702720120
otosivasli.comcom100420140
kendimden.comcom902520160
yoresellezzet.netnet1301620182
denizlimuzikkursu.comcom1712620170
medikolegal.orgorg110820132
benimlegezermisin.comcom1701220160
gonullumerkezi.orgorg140020180
akpartiliadaylar.comcom160920140
medcezir.orgorg816920185
caksirkoku.comcom100020180
antikmetal.netnet100520181
kayhankikkaya.comcom130020180
cagricatering.comcom1341120180
modasayfam.comcom1077720140
dogrunokta.comcom100720181
bosphorusmarble.comcom150020180
bosphorusstone.comcom144220180
gosterisanatlarimerkezi.comcom230920150
atillataner.comcom1132420181
jusacademy.comcom1001020180
egitimkutusu.comcom120220180
temizliksirketleriistanbul.comcom260720160
yoldanevar.comcom1001220180
tezcanlaryapi.comcom130820180
sesliyes.orgorg811720172
bbleague.orgorg8247420182
hasberkavm.comcom1001820180
ballikoyanzerbali.comcom1711420180
radyotunel.comcom100020180
gulnarem.comcom801020100
esenyurtdekorasyon.comcom1802220180
temizliksirketlerifiyatlari.comcom2701920160
konyarobot.netnet100020181
alemmedia.comcom90820181
pendikhaliyikama.orgorg1603020162
irfankizilkaya.comcom1412920100
yavuzyilmaz.orgorg1102920155
elisipazari.netnet110720180
basdent.comcom714120160
transferkayseri.comcom1501320140
islamzade.comcom90320170
turdeb.orgorg60820181
alarmizleme.comcom110120131
reklamantalya.netnet130720161
tekfm.netnet534720181
osmanduzgun.comcom110520181
kehribartesbih.netnet1401720184
wildsro.comcom7201920180
geredeharita.comcom1241220180
istanbultshirt.comcom140920180
toowomen.comcom841220180
cesainsaat.netnet100520182
dunyapet.comcom801720141
kardeslerdiyari.comcom1501320180
cukurovamanset.comcom1429020162
mobilyatamir.orgorg120920182
selimdekorasyon.comcom150620180
fikrivesinaihaklar.orgorg1801020161
kullaniciyorumu.orgorg1502620171
katkarsiligiinsaat.netnet180020142
asurbilisim.comcom111191520150
kombiparcalari.comcom1404020161
dozirik.comcom70220180
modabana.comcom801020140
modabana.netnet80020140
tahirsert.comcom90020180
cayirovacilingir.comcom160020180
eldivenborsasi.comcom140020180
matbaadayim.comcom11501020140
eleganss.comcom80020180
cekmekoytemizlik.comcom1601220100
kadikoytemizlik.netnet150920101
pendiktemizlik.netnet140820101
tuzlatemizlik.netnet130720101
oskaymuhendislik.comcom160320180
cebimbenim.comcom1002320180
evdeneveparcanakliyat.comcom213015220140
yildirimtemizlik.orgorg168020182
dalamanhavaalanitransfer.orgorg2481820181
elitiumtipmerkezi.comcom170820120
kullanici-yorumlari.orgorg1916420181
ikggrup.comcom70020180
rananews.comcom84020180
celikcatiistanbul.comcom1703620180
medyaturkfm.netnet1101020151
chatmy.netnet60720171
ibrahimadiyaman.comcom150020180
istanbulhurdacilarsitesi.comcom2401520180
sahinhurdametal.comcom157320181
gulercasing.comcom11132620130
hyundaiyedekparcalari.comcom2152320130
hypebet.orgorg70020186
spotajans.netnet901320151
egepalet.comcom801420150
havadisankara.comcom1373420180
alingrup.comcom80720160
ee-dekor.comcom801920160
dogrunokta.netnet100020181
daricacilingir.comcom140220180
ozpetltd.comcom801320130
hostdc.orgorg60220184
metsad.orgorg63720154
zerastore.comcom961020180
tanerozturkmusic.comcom160420180
buyuksiirbelediyesi.comcom1901220181
poyrazdanal.comcom110520150
ankaraunyelilerdernegi.comcom225020180
sozlerisarki.netnet1201520172
bitadilat.comcom901120160
birincihastanesi.orgorg160720150
humanitarianact.orgorg1501120150
ijess.orgorg501720142
komsuyemegi.orgorg110620141
musacinkilic.orgorg1242120140
okanspor.orgorg80920172
radyogul.orgorg801420072
sahinerdem.orgorg1001220171
sidetransfer.orgorg1200201812
sivilsayfa.orgorg100820100
tautmann.orgorg82020184
yasamboyuegitimakademisi.orgorg2401720100
adapazariaqua.comcom130120130
allegrokimya.comcom120120140
ataparotomotiv.comcom140520180
basaksehirkalicimakyaj.comcom220120140
cornboxistanbul.comcom150120150
creepersturkey.comcom140120140
dilbahcesi.comcom100120120
diyarbakirhavalimaniarackiralama.comcom320120140
diyarbakirhavalimaniotokiralama.comcom310120140
dogalgubreci.comcom1265820140
enucuzroman.comcom110120150
fatofotofan.comcom1101920150
fonexprofessional.comcom170020080
fonexprofesyonel.comcom1613120080
bartinyaziciyapi.comcom160420160
goyayincilik.comcom120120140
goyayinevi.comcom100120140
hairtransplantationclinicturkey.comcom310520150
hasankulak.comcom1001120130
hassamimari.comcom110120140
hatayalarmizleme.comcom160020130
hatayalarmtakip.comcom150020130
havlamatasmalari.comcom160120140
hesaplikombimarket.comcom180120140
hotshaperstayt.comcom140420182
axistalu.comcom81120180
kandisinsaat.comcom1201020170
kastamonuikinciel.comcom1701220180
kekburger.comcom90120150
keniturizm.comcom100120170
kitbilisim.comcom100020180
maksimses.comcom90120170
markacambazi.comcom120020140
melisadekorasyon.comcom160720130
mersinbba.comcom92130820180
minikkalbim.comcom111520180
musaanzelya.comcom110020180
zkusagi.orgorg702120164
oktayyavuzarslan.comcom160120180
onursa.comcom61520180
onurstore.comcom90520180
oto-destek.comcom100620150
ozcanlaraluminyum.comcom170120140
pasajclub.comcom9455920120
ankararulocim.orgorg1301320161
bursakentgonulluleri.orgorg2023820160
dunyamedyamerkezi.orgorg170620160
erasummit.orgorg9976920161
eyupaydemir.orgorg110620163
kirsalplanlamavetasarim.orgorg230520160
mehmetsalihkartal.orgorg170020160
adivgroup.comcom97120160
almusbotanikpark.comcom160920160
basdenteryaman.comcom1401420160
basdentsokullu.comcom1401420160
cigizolasyon.comcom1201120160
dessakuyumculuk.comcom1511920160
furkanbardak.comcom120020160
harbiyeinsaat.comcom130120161
kentkurslari.comcom1221520160
mesutofset.comcom100420160
o-payment.comcom91620161
purupara.comcom80120160
qbonimerchant.comcom1301220160
sigacikmarinaapart.comcom180120160
tetamak.comcom732020160
vadispa.comcom70320160
baticel.netnet70020162
boracakiroglu.netnet130020161
fairpizza.netnet984020162
tetamak.netnet70020160
tevhidnedir.netnet1115820161
vrholiday.orgorg90420184
kilifreyonum.netnet120020181
eminumrem.comcom90020180
tekposis.comcom80120180
schusterbayi.comcom1221820150
elffoptik.comcom90020180
fdicmimarlik.comcom120020180
yapimodelleri.comcom1301120170
elazigeimza.comcom11531520180
juniorbisiklet.comcom140620180
drfatmasen.comcom100120180
fidankundura.netnet127842620142
ismailmalatya.comcom130120180
anatoliasolarium.comcom163120180
malatyadis.comcom101720180
rocknistanbul.comcom1301320130
baskantur.comcom90220180
hepsinibulursun.netnet150020171
yalovakahvalti.comcom141020180
stemkulubu.comcom100020180
sanalayna.orgorg91501120171
baharzuccaciye.comcom140020170
blackmussel.comcom110320170
dogatemizlikaydin.comcom1701420170
foxiter.comcom70120170
iyisayfam.comcom9207020170
kanbankamiz.comcom1121320170
kayseriataksk.comcom130320170
kuaforstogu.comcom110120170
menderesstarcicekcilik.comcom220120170
misdevrandoner.comcom140120170
obiorganic.comcom100320170
obiorganik.comcom100020170
otoshowmodifycenter.comcom190120170
ozharunnakliyat.comcom150320170
pasifikinternet.comcom150320170
pratikac.comcom80120171
stressarki.comcom100120170
tersineyasam.comcom120120170
yaparsakneolur.comcom140020170
yedoysandvic.comcom120420170
atolyerengarenk.netnet150120170
itestbook.netnet90020171
kuaforstogu.netnet110020170
mezathane.netnet90020171
yedoysandvic.netnet126320170
yeniturkiyezirvesi.netnet180020172
tekeyapi.comcom80020180
evimdeguzel.netnet110020180
sibelozpulat.comcom120020180
sakaryaaqua.comcom110120130
solarfirsati.comcom120120150
solargazetesi.comcom130120150
teknikcollection.comcom1601620130
televizyonluyatak.comcom170120110
universalkumas.comcom140120150
yokmuazaltan.comcom120120140
elitiumtipmerkezi.netnet170720120
enucuzroman.netnet110020150
esmasimsek.netnet100020151
fidanayakkabi.netnet130020141
kazazi.netnet601220113
otomatkeyfi.netnet110020151
solarsepet.netnet100320151
sporpoint.netnet90020101
tokatelsanatlari.netnet160620141
tokatyazma.netnet100020143
texka.comcom51420182
doziric.comcom721120180
2018depremyonetmeligi.orgorg210020180
4leventpilates.orgorg140020181
akilbilimozgurluk.orgorg170020180
asiloglunakliyat.orgorg161020180
bigonullu.orgorg90120180
depremyonetmeligi.orgorg170020180
ebleague.orgorg80020181
haypanakliyat.orgorg131020180
hydraclan.orgorg90020181
islamimucadelebirligi.orgorg210020180
medikalalsancak.orgorg150020181
modalanaliz.orgorg110020180
musavircalismaizni.orgorg180020180
musavirisyeriruhsati.orgorg200020180
musavirturizmbelgesi.orgorg200020180
musavirturkvatandasligi.orgorg230020180
musavirturkvatandaslik.orgorg220020180
musavirvatandaslik.orgorg180020180
musavirvatandaslikbasvurusu.orgorg270020180
musaviryabancicalismaizni.orgorg250020180
musaviryabancilaracalismaizni.orgorg290020180
pilates4levent.orgorg140020180
possafe.orgorg70020184
solennakliyat.orgorg131020180
ttso2018.orgorg818020180
worldarchitectscouncil.orgorg220020180
arcelikbekoyetkiliservis.orgorg240120180
armay.orgorg50020187
butiknora.orgorg90020181
kosadef.orgorg70020180
promerk.orgorg70020186
pro-merk.orgorg80020181
reisocaklarikonya.orgorg170020180
sagliksenizmir1proje.orgorg200020180
sakodef.orgorg70020180
saruhan2.orgorg84420180
siyahbeyazorganizasyon.orgorg220020181
takimarkadasim.orgorg140020180
takshootnew.orgorg110020180
arostesmt2.orgorg106220180
bacakinceltencorap.orgorg180220180
batmanumutkervani.orgorg170020180
borbey.orgorg60020182
bravesteve.orgorg100020180
direnisteyiz23.orgorg1411120180
gunduzyalcin.orgorg120020180
sbt90t.orgorg60020180
senso2.orgorg60020184
yerlihayvancilik.orgorg160020182
kullaniciyorumlarisitesi.comcom240020180
4449907.comcom70620180
agirkapimeyhanesi.comcom170020180
agirkapirestaurant.comcom180020180
agirkapirestoran.comcom160020180
akanatarim.comcom100020180
antalyadaortodonti.comcom180020180
antalyarenkhaliyikama.comcom210020180
antrenmankutusu.comcom150020180
aracfilosistemi.comcom150020180
arpaciogludanismanlik.comcom210020180
asosskartus.comcom110020180
asrizerafetdiyarbakir.comcom210020180
atolyekomsu.comcom110020180
atomkatki.comcom90020180
aygunlerfiber.comcom134020180
ayyildizsporcenter.comcom180020180
batmanaltinoran.comcom151020180
bekarogluantalya.comcom160020180
bitcoinyayinlari.comcom160320180
blackcamsecurty.comcom150020180
bloomingdesignm.comcom150020180
bogazdadavetorganizasyonu.comcom250120180
butiktesettursepeti.comcom190020180
canakkaleyapimalzemeleri.comcom240020180
capalimakine.comcom120020180
caykart.comcom70020180
cenkevdeneve.comcom121720180
cepgarantim.comcom110020180
cepten-kampanya.comcom150020180
cihangirmobilyadoseme.comcom210020180
citycenterotel.comcom140620180
coregenha.comcom90020180
corlucilingirim.comcom152320180
dhdkurumsal.comcom110420180
dijisocial.comcom100020180
dogangulerreklam.comcom160020180
elegantabajur.comcom130020180
eminkulturturlari.comcom170020180
eniyinargilemekanlari.comcom211020180
enyakinservis1.comcom140020180
evimdeguzel.comcom110020180
farmasiuyeoll.comcom130120180
fizyolifeturkiye.comcom164120180
flucekim.comcom80020180
gaziagac.comcom80020180
gaziantepototamiri.comcom180020180
geneladam.comcom90020180
gozluktime.comcom100020180
grippershoes.comcom120020180
gtosterapibatman.comcom160020180
guvenilirdaire.comcom140020180
guvenilirdaireler.comcom170020180
guvenlidaireler.comcom150020180
haburozelguvenlk.comcom1617420180
halkalisuaritma.comcom1518020180
havacilikmarketi.comcom160020180
hazalozluk.comcom100120180
hurdaaracborsa.comcom140020180
hurdaotoborsa.comcom130020180
hurdaotoborsasi.comcom150020180
huseyinatesinsaat.comcom170020180
ibisusta.comcom80020180
idilkumral.comcom100020180
impaelektronik.comcom140020180
kayatekoto.comcom103420180
kocabaslartarim.comcom150020180
konyarezzta.comcom110020180
kucukplanlama.comcom130020180
lantayapi.comcom90020180
lefrechtacos.comcom120020180
liderakademiizmit.comcom170620180
malatyaatakevdeneve.comcom190320180
masiakbari.comcom101220180
mehmetkutuk.comcom110720180
mersindesotti.comcom130020180
mersinnetegitim.comcom150020180
mhmsunucular.comcom121020180
milathastanesi.comcom140020180
mobilyaindeks.comcom130020180
mobilyaminbaskenti.comcom180520180
mordof.comcom60020180
mummytattoomarmaris.comcom190020180
nazeninizgara.comcom130420180
ncrmedya.comcom80020180
newhudsonderi.comcom130020180
nfssuaritma.comcom110020180
okudeger.comcom80020180
okuldeneylerim.comcom140020180
otoservislergrubu.comcom170020180
ozelankaraogrenciyurtlari.comcom250020180
pazarsepetimde.comcom140020180
pearmobil.comcom90120180
randevuotomasyon.comcom160020180
rezztakonya.comcom110020180
robotkonya.comcom100020180
sakaryaosmanlihaliyikama.comcom240520180
salonzeynep.comcom110020180
samsunkinatahtikiralama.comcom230020180
sefailyasoz.comcom110020180
serinnokta.comcom100020180
seslenenadam.comcom120020180
seslenensiir.comcom120020180
shahlahastanesi.comcom150020180
shahlahospital.comcom140020180
shahlamasaj.comcom110020180
shahlamassage.comcom130020180
shahlamedicalmassage.comcom200020180
shahlamedikalmasaj.comcom180020180
smmservis.comcom90620180
sosnorthcyprus.comcom140020180
sosyaldestekler.comcom150020180
tahatedarik.comcom112020180
tekseansgtosterapibatman.comcom240020180
telefontedavimerkezi.comcom200020180
toplanmamerkezi.comcom150020180
trabzonperdemelek.comcom170020180
tugraziraat.comcom110020180
turkcuronesans.comcom140020180
turkeruras.comcom100020180
unsalyapimarket.comcom157020180
upmimari.comcom80020180
uzlastirmatik.comcom130020180
varansoy.comcom87120180
villabakim.comcom100020180
yetkilii-servis.comcom150020180
yuzikiyapi.comcom100020180
yuzikiyapimalzemeleri.comcom210020180
35mmproduction.netnet140020182
adarobot.netnet80020183
atomkatki.netnet90020180
bulmacaturkiyedergisi.netnet210020181
buyuksiirbelediyesi.netnet190020181
cepgarantim.netnet110020180
duvargrup.netnet90520181
foodpackist.netnet110020180
gaitanakli.netnet100020181
gaziagac.netnet80020180
isgprofesyonelakademi.netnet210020181
konyarezzta.netnet110020180
ncrmedya.netnet80020180
randevuotomasyon.netnet160020180
rezztakonya.netnet110020180
robotkonya.netnet100020180
seluxturkiye.netnet120020181
serinnokta.netnet100020180
seslenenadam.netnet120020180
seslenensiir.netnet120020180
toprakotomasyon.netnet150020181
urganip.netnet70020181
urganiplik.netnet100020181
urganyarn.netnet90020181
uzlastirmatik.netnet130020180
yalovakahvalti.netnet140020180
yoldanevar.netnet100020180
felicisko.netnet98120180
lefrechtacos.netnet120020180
toowomen.netnet80020180
urfafanatik.netnet110020181
cafeyedi.comcom80420140
marsikcocuk.comcom1101820120
beygundem.comcom90320180
eniyibal.comcom821220180
efsanehosting.comcom1302120180
sariyer-evdenevenakliyat.comcom240020180
eniyileri.netnet922320183
umraniye-evdenevenakliyat.netnet2501420180
btkiu.comcom50820180
boxxair.comcom70020180
ankaradasacektirme.comcom180020150
gelintacimodelleri.comcom1861520140
guestartr.comcom912120130
gulayerturk.comcom1121520180
iclalmutfagi.comcom1213420150
konyayunusemre.comcom145820140
susluhafizhalilayhan.comcom200420160
phovistudios.comcom120020180
yaseminsu.comcom90020180
e-sevgili.netnet92220181
eryamanfayansustasi.netnet192020171
biordabiburda.comcom1302720170
halildenmasallar.comcom160020170
melihkutaykaya.comcom14722320171
selasyapi.comcom90220170
sempatipetotel.comcom14201020170
zamundatorrentten.comcom17502120170
2025sos.comcom70020180
acroindustry.comcom120020180
acroplasma.comcom100020180
aydinlikdis.comcom110020180
biorezonanslabiraktim.comcom210020180
biorezonanslakurtuldum.comcom220020180
biorezonanslazayifladim.comcom230020180
cittamyoga.comcom100020180
eljotek.comcom70020180
filterextreme.comcom130020180
geekybargain.comcom121020180
innocorn.comcom840020180
karamanarsa.comcom110020180
kartalevdenevenakliyatim.comcom240020180
karyapgyo.comcom90020180
kasvagomlek.comcom110020180
kreatifci.comcom90020180
kutukdergi.comcom100720180
modalitemizlik.comcom140020180
murathankuyumculuk.comcom180320180
mutfakfiltresi.comcom140020180
mysaloonkonya.comcom130020180
seferpetrol.comcom110020180
sermaninsaat.comcom120020180
simbatasarim.comcom120020180
stilniobuvkibg.comcom140620180
viptransfersehri.comcom160220180
yahyabaykal.comcom110020180
cekmekoyevdenevenakliyatim.netnet260020181
nilena.netnet60020182
universalotomat.netnet152620181
uskudarevdenevenakliyati.netnet240120181
accmakina.comcom99919120030
e-cnk.comcom5466320110
mitsubishiiraq.comcom140620180
pelikanotokiralama.comcom1852520180
cagdasgelinlik.comcom1414320081
betamedikal.comcom1124920132
sevalyapi.comcom90420180
karizmacelikkapi.comcom1662020180
sanalmalatya.comcom1201220180
ozsevay.comcom724620050
duysanun.comcom825320160
dagcireklam.comcom1183820160
mosguvenlik.comcom1155620070
bedenegitimimalzemesi.comcom2101120090
borudergisi.comcom113613820080
e-seda.comcom6114520171
guvenmedya.comcom1014520161
dekordograma.comcom1222520160
denizgumus.comcom1001620180
hizyapi.comcom701320180
baniinsaat.comcom100720180
peturunleri.netnet1192120182
istanbulkarot.netnet130620123
arslanprefabrik.netnet1533020101
otobakim.netnet803020056
agkyapi.comcom70620181
cakmak-insaat.comcom1312420101
otokiralamalar.comcom1469020160
smartpaym.comcom90020180
turkiyede.netnet902920184
berberogluyapimalzemeleri.comcom25142320100
enginpulat.comcom1071220170
daphneajans.comcom1164620160
kurbankesim.comcom110520120
internetbagla.comcom130220180
yarenguvenlik.comcom1323720180
necsis.netnet601820124
cevrebilisim.comcom120120180
evineal.comcom70120180
genckitle.comcom901220180
canlibahisleri.comcom1473020160
daimsolar.comcom90020180
bosanboyama.comcom1101620081
onerisepeti.comcom1101720130
konyafotograf.comcom1301120140
sanalerzurum.comcom120220180
mudanyaevdenevenakliyat.netnet2361320182
hastabakiciniz.comcom1406620180
sanalsivas.comcom100320180
aysmatbaacilik.comcom141320180
manypattern.comcom110020180
saattr.comcom604020130
ottomancatering.comcom150620180
bozkurtguvenlik.comcom1501820180
projedemo.comcom926720142
gelinlikonline.comcom140920180
boykap.comcom60320181
sametdekorasyon.comcom150220180
partigunu.comcom90020170
hayalduvari.comcom110020180
gaziantepsacekimmerkezi.netnet2302220171
fordyedekparcam.comcom1502720160
aygundiamera.comcom1211820140
sanalzonguldak.comcom140020180
ergareklam.comcom108122420160
karacabeyevdenevenakliyat.netnet250020182
sanalisparta.comcom120020180
iznikevdenevenakliyat.comcom210020180
samsunpanjur.comcom120720150
sanalamasya.comcom110020180
hakansilver.comcom110020180
universitekirtasiye.comcom190620180
erdemkurt.comcom90320170
atakvinc.comcom80020180
mobilyaadresi.comcom1301420170
yesilmalatyagida.comcom160920030
agiz-dissagligi.comcom1512284020120
sanalgiresun.comcom120420180
ormekhaliyikama.comcom150020180
paidlater.comcom90020181
araltohum.comcom90120150
modaeksen.comcom928514720150
bagajpaspasci.comcom13285020180
marmarisbitpazari.comcom170020180
kalenderkardesler.comcom1701220181
midyebira.comcom90020170
dizipub1.comcom802620180
celik2.comcom60020180
cevreonline.netnet110020181
leyladanismanlik.comcom1601020180
alevunel.comcom802120130
oshgsu-kuu.comcom10992520140
sirinlerkasabasi.comcom1601820180
seperatorcu.netnet111020181
shopandswim.comcom1101020150
alperbasda.comcom103020180
uandifilms.comcom100020181
sessizdinamit.comcom130020160
sessizyikim.comcom110020160
mecidiyekoydeanaokulu.comcom210520180
likereklam.comcom100020180
hadibak.netnet701420181
3dboyama.comcom802220130
acilkarot.comcom90020120
adhesivetapesworld.comcom180220120
arsantalya.comcom100020140
aytuncdekorasyon.comcom161220120
azerbaycanhavayolu.comcom180020130
bestepetasimacilik.comcom180020150
besyolkizyurdu.comcom14134520130
bistbul.comcom70020130
bistfinans.comcom100020130
bistpara.comcom80020130
camtemizlemerobotu.comcom180020150
caniksepeti.comcom110720150
cicekalcicek.comcom120020150
ciftcisatis.comcom111020180
db-anket.comcom811220140
delovayaturtsia.comcom1501320100
donatemebtc.comcom110020180
gokcangokmen.comcom120420090
kayseripvccambalkon.comcom190120160
ozcekicyapi.comcom1101120160
haisiatours.comcom110020140
implant-sitesi.comcom1401220120
istanbulgocukduzeltme.comcom210220180
karotcuzafer.comcom120720120
karsayisigi.comcom1101720130
kpgayrimenkul.comcom130020180
kumpirhane.comcom100020180
kurbankesimmerkezi.comcom180220120
laleborek.comcom914520181
kimdirvenedir.comcom130220180
modaperver.comcom100120180
optimizeacademy.comcom1532420152
organizefilmler.comcom1521620130
osmanteke.comcom90120140
piezomikrometrikburunestetigi.comcom290020150
piezomikrometrikrinoplasti.comcom260020150
bivaliz.comcom70120161
burelbaby.comcom90020160
eminilac.comcom80020160
ideal-cam.comcom90120160
isiverimlilik.comcom130020160
kentistturizm.comcom130120160
landmartistanbul.comcom160020160
mehirailedernegi.comcom160020162
otoadanakiralama.comcom160120160
otokiralamalaradana.comcom190120160
unisignmedia.comcom120020160
unisignsurvey.comcom130120160
worktastefully.comcom140020160
wwwkaromakinaistanbul.comcom210020160
eminilac.netnet80020160
istanbulgezide.comcom1402720180
betpas22.comcom8641620180
ormekhaliyikama.netnet150020180
sandalyeciyavuz.comcom150120180
agroturco.comcom9116320180
locadoner.comcom921020180
ikincielesyaalanyer.netnet1903320182
kalenderkardeslerkuyumculuk.comcom270320180
dxtur.comcom50020181
asdemnakliyat.comcom133520180
yorkiraq.comcom80120180
hartman-tr.comcom100020170
gulaytextile.comcom120020180
alarrabconstruction.comcom190120170
bahariyehukuk.comcom130020170
gonulholding.comcom120020170
pacificgyo.comcom100120171
projegorsellestirme.comcom192120170
rota-tv.comcom70020170
rotafit-tv.comcom100020170
rotafittv.comcom90020170
sehirlerarasinakliyattr.comcom230620170
vektoranaokullari.comcom170220170
vektorokullari.comcom1401420170
modamicro.netnet90020171
rota-tv.netnet70020170
rotafit-tv.netnet100020170
rotafittv.netnet90020170
ferhatyildirim.netnet1401620184
ankarafuarstand.netnet1542220151
smurfstown.comcom100820180
samsundonerkapi.comcom150020150
samsunkapiotomasyon.comcom190020150
serviscagrimerkez.comcom170320152
unutbenipegasus.comcom150120120
bionur.netnet60020154
delovayaturtsia.netnet1501220100
eltesresidence.netnet1401020070
goldasansor.netnet110720142
haisiatours.netnet110020140
hizlicinvizesi.netnet140020141
whoisataturk.netnet120420101
kayseriavukat.netnet130020184
dengeselyasam.netnet130320182
agroturko.comcom90020180
ciftcitakip.comcom111020180
kismetperde.comcom110020180
adastonetile.comcom120020180
akhisaretkinlikleri.comcom191620180
akillimera.comcom100020180
altinparkaltincafe.comcom180020180
amazonsatisdanismanligi.comcom230120180
antalyatemizlikofisi.comcom201020180
aselkaexport.comcom120020180
astelkablo.comcom100020180
atabilgeturk.comcom120020180
atillainann.comcom116020180
ayermining.comcom100020181
banisadakat.comcom110020180
basagrimasi.comcom116020180
bbozkurtinsaat.comcom141020180
bilisimbote.comcom110020180
biyometre.comcom90020180
bulutdekarasyon.comcom150020180
catalcameczanesi.comcom160020180
cigercicuma.comcom110420180
computtaturkiye.comcom154020180
conatekstil.comcom110020180
daimenerji.comcom100020180
damlakarakose.comcom130020180
deltaxtravel.comcom120020180
deltaxturizm.comcom120020180
drdenizoner.comcom110020180
dxturizm.comcom80020180
e-ipekcim.comcom90020180
ecodemiadogaokulu.comcom170020180
entegrami.comcom90020180
erol50.comcom60020180
etimgelsin.comcom100020180
ewdode.comcom60020180
falconpckadikoy.comcom150020180
furureofart.comcom110020180
gencerbarkod.comcom120020180
gencotonomi.comcom110020180
goldkaju.comcom80020180
hairarabicturkey.comcom162020180
hamzatercan.comcom110020180
handeperim.comcom100120180
helicoptertoursistanbul.comcom230020180
hkgroupkumlama.comcom142020180
hscsuaritma.comcom110120180
ingilizce-oku.comcom130020180
inseyw.comcom60020180
istocislakhacim.comcom150120180
izmiremirotokiralama.comcom200020180
kam10tv.comcom70020180
kareicerik.comcom100020180
kastamonukulturbaskenti.comcom230020180
kestelevdenevenakliyat.comcom220020180
keydavet.comcom80020180
kfbsocial.comcom90020180
kuruyemisotomasyonu.comcom190020180
kusotokurtarici.comcom150020180
likekonsept.comcom110020180
likesosyalmedya.comcom150020180
lojimakina.comcom1001220180
lostcityyapi.comcom120020180
maasakadar.comcom100020181
mevlanaistihdammerkezi.comcom220020180
missetre.comcom80020180
msmagri.comcom713020180
mustafakemalpasaevdenevenakliyat.comcom320020180
mydresssup.comcom100020180
nasesgroup.comcom100020180
nikyapi.comcom70020180
officevrem.comcom100020180
osmangazievdenevenakliyat.comcom253020181
pembeponcik.comcom110020180
plekseva.comcom80020180
prekastgroup.comcom120020180
redekomobilya.comcom130020180
sahmatdesign.comcom120020180
sanalafyonkarahisar.comcom190020180
sanalagri.comcom90020180
sanalbolu.comcom90020180
sanaledirne.comcom110020180
sanalelazig.comcom110020180
sanalkahramanmaras.comcom180020180
sanalsanliurfa.comcom140020180
sanalyozgat.comcom110020180
sardunyaayvalik.comcom150020180
sentezagile.comcom110020180
sentezdelux.comcom110020180
sentezdeluxe.comcom120020180
sibelkaran.comcom100020180
sikayet54.comcom90020180
sivricecicekbutikotel.comcom210120180
smartcompte.comcom110020180
sporstores.comcom100020180
tiyatrokronotop.comcom150020180
topraksizagac.comcom130020180
toshibairaq.comcom110020180
ucelendustri.comcom120120180
usenmezlerharfiyat.comcom183220180
vikingavmarketi.comcom150020180
voguemimarlik.comcom1314020180
yazilimcipazari.comcom150020180
yilmazkuzucu.comcom120020180
biyomod.netnet70020183
hepkalfm.netnet811320183
inantesbih.netnet100020181
portalankawall.netnet140020182
risemt2.netnet79120180
sahibindensin.netnet130020180
sincantabela.netnet120020181
yenisehirevdenevenakliyat.netnet250020181
billwalk.netnet80020181
kam10tv.netnet70020180
temizlio.netnet80020181
nuribattal.comcom1004120080
akasyaototest.comcom1312120120
ikincicumhuriyet.comcom1644320171
datayedekle.comcom110720180
ief-int.comcom702620150
alotasarruf.comcom110020150
hedefgrass.comcom1011220080
taniauto.comcom810915320091
aspethukuk.comcom10474020030
zeynepdeniz.netnet1123520161
benguyayincilik.comcom15433420100
faldan.comcom60320141
falkutusu.comcom91282220140
geziyap.comcom703420150
vahaperdogdu.comcom122983620150
sikayetlerim.comcom1213520140
yayindinle.comcom10173420121
torpilsiz.comcom952420150
filmtarama.comcom100620140
cpmready.comcom876420150
pvccekvalf.comcom100120180
mallcell.comcom80820170
emekmarket.comcom100320180
ayrandolum.comcom10232720160
ahestebalik.comcom1112320180
egitimbizden.comcom120220180
pissucekvalf.comcom1201320180
balsut.comcom60120181
aynorganizasyon.comcom1501920160
lejyon.netnet601020161
eymenyapi.netnet90420180
marinpartner.comcom1201020173
evceyizi.comcom80020180
beyazvipdizayn.comcom1403020140
zeytinyagipinari.comcom1601220120
egesistemguvenlik.comcom1705020140
izmirpanasonicklima.comcom1956020180
projesahasi.comcom1101120150
alasehirfirmarehberi.comcom200020180
businesshdf.comcom1142420150
kardeslercati.netnet134720172
afiumparfum.comcom110020180
aksehirsurucukursu.comcom1813720150
aktuelarkeolojiyayinlari.comcom2414020130
alperkadioglu.comcom130020140
archaeoshop.comcom110020130
cumabereketi.comcom1201820110
cxmanti.comcom70020140
eniyisolar.comcom100020150
figurdogaltas.comcom13232920150
goncakaynar.comcom110120160
imanmedresesi.comcom130220170
kaygisizgurme.comcom130020150
ledlifecyprus.comcom13101020150
mazdaclubturkiye.comcom1601320080
oztasgyd.comcom80120140
pimparcekvalf.comcom130920180
cherycikmaparcalari.comcom1931216820160
chromeactiongames.comcom1714320160
ghazalresortthalasso.comcom200120160
bidolumagazin.netnet133520181
berkalem.comcom81720180
ahesteetbalik.comcom133420180
solariumlife.comcom121951120180
iconparkincek.comcom130420180
e-grossmarket.comcom130020180
isyapyaptir.comcom110020180
imanmedresesi.netnet130020170
imanmedreseleri.comcom150220170
ozdoganmismis.comcom132220170
imanmedreseleri.netnet150020170
sezayikaya.comcom10742720150
solarkeyfi.comcom100020150
yalcinsupermarket.comcom1741220150
alperkadioglu.netnet130020140
denizlipsikolog.netnet150020141
kuruyemisciprogrami.netnet190020150
afiumkozmetik.comcom130020180
ahuyapi.comcom790446020180
ayyildizvip.comcom110020180
bamaara.comcom70020180
basilicaterma.comcom130020180
batipestilaclama.comcom160020180
betagruptasarim.comcom150020180
bilmartasarim.comcom1342220180
buyuyenyapi.comcom110020180
drokanturk.comcom100620180
ekologlogistics.comcom1522020180
fezakoca.comcom80020180
harman23.comcom80520180
icmalinsaat.comcom110020180
izerotomotiv.comcom120020180
izmirkinaorganizasyonizmir.comcom260020180
kayseriaslinakliyat.comcom190020180
legnomoderno.comcom120020180
mgmavigrup.comcom102320180
mirzabeynakliyat.comcom160320180
myyapistore.comcom110020180
omevapide.comcom90020180
plastikcekvalf.comcom140020180
purpuur.comcom70020180
sardesinitiative.comcom160020180
steamkeykazan.comcom130020180
tribun90.comcom80020180
uzaymuzikleri.comcom130020180
uzaymuzikleriakademisi.comcom220020180
aracpaylasimi.netnet130020181
zekeriyakaraman.netnet150020181
cemrerehabilitasyon.netnet190920181
drokanturk.netnet100420180
liefurla.netnet80020181
telekom-evinternet.netnet180020180
eksijenexpo.orgorg110020180
seslihanci.comcom100420180
turchat.comcom706420180
turchat.netnet71020180
transsyria.comcom100920150
barkom.comcom6232200510
antalyakiralikklima.comcom1901320120
volse.netnet501120126
dinlerisi.comcom901220070
e-sistemler.comcom110020110
presproses.comcom1032620110
e-sistemler.netnet110020110
marmaristur.netnet111020182
atlantahomemart.comcom1585520030
cesurradyo.comcom101154620160
enginatik.comcom931020170
komikgaleri.comcom11126420180
mersinhentbol.comcom135616820181
sosyetegiresun.comcom1411820140
memestory.comcom901320170
hostpointe.comcom10104220160
germanpolka.comcom1101920170
cherrysart.comcom1027220170
giresunsosyete.comcom140820140
yarimekmek.comcom107492920160
yalcintorna.comcom110920130
markbocek.comcom9507420180
kayserihentbol.comcom14258520180
solovenezuela.comcom1324120050
agorabilisim.comcom12710920171
bingolsozluk.comcom12207620170
fetihkofte.comcom10143420180
cimacuernavaca.comcom1403020180
resimdepo.comcom978220100
greenforestotel.comcom1503320171
bravoangels.comcom11266220180
yellowsperm.comcom1134720160
enerjigundem.comcom121199820170
annasenatore.comcom121920181
vahsihayat.comcom1073020080
durmakazan.comcom1001020170
cilekyazilim.comcom1222620180
armaganoguz.comcom1102120140
erotikdunya.comcom115412420170
urunmerkezi.comcom1177420160
starrhillbeer.comcom13345120170
oldtownlegal.comcom1212620180
selester.comcom801120163
michaelamir.comcom1101320080
maestroallen.comcom12104820180
avantajhost.comcom110120180
orientmania.comcom1101120121
efsanepanel.comcom1133420180
villaexcelsior.comcom1432520140
sahinturkinsaat.comcom1501720180
ortaasyali.comcom1073820090
mantasafari.comcom1142920180
karladam.netnet80220183
tekme.netnet5158201610
imge.netnet491190199832
orenplast.netnet91405220182
amberstewart.netnet1294320132
vasif.netnet53102720154
duvar.netnet5027200516
groundplan.netnet10038201814
deltasone.orgorg912220162
rayic.orgorg50720162
pokerster.comcom903620181
portalself.comcom100020181
taksimreklam.comcom12853220170
chocotest.comcom921620160
erinjadeyoga.comcom1272520100
noktaveri.comcom901220160
venusflix.comcom901020180
princehost.netnet100220153
bambuware.comcom90220180
amasyaturizm.comcom120920170
hiraajans.comcom913262720170
amberwaller.comcom1101420130
floristation.comcom120020180
kopruyazilim.comcom1202020180
ayvaliktost.comcom1101420121
helensalisbury.comcom1401220170
martisland.comcom100620170
americandilemma.comcom1501120160
armagansahin.comcom120120160
exportkaro.comcom100120170
oliviahale.comcom1001020180
metrodenverhome.comcom1502820170
videorendering.comcom1402420181
saragraves.comcom100720181
powderforum.comcom113720140
kzlar.comcom5367920182
yarisprice.comcom100120121
gunceldizifilm.comcom1402420140
sarasandberg.comcom1201020172
manawarangal.comcom1202020142
portugalpass.comcom120320171
claphamomnibus.comcom1402520141
oncefragman.comcom1101220180
medyumalex.comcom100520170
dundeemarina.comcom1201420132
pokerenter.comcom100820180
ozelolcudolap.netnet130320181
parsagency.comcom100120160
satvet.comcom60920140
muzikmania.netnet10387520181
mamarana.comcom8163620170
lindsayhausch.comcom13283020110
cherryhillmenus.comcom1514920180
titanmonitor.comcom120420171
ozelmakale.comcom1004320160
izmirmimar.comcom1073820140
forkliftcollege.comcom153491720100
altaylojistik.comcom1324520140
vadimobilya.comcom112220160
nadirfilm.comcom921120180
abismotor.comcom942820180
sanibelestates.comcom1402420020
waltersmail.comcom1103020170
metrosatis.comcom100520140
videochad.comcom912220130
andreaskamp.comcom1101020121
startimestudio.comcom1415420180
yurticidagitim.comcom14625820110
ringsart.comcom80720170
bahtdeal.comcom801220180
kalendermesrep.comcom1433320170
mecmu.comcom501320181
uzlastirici.orgorg110020183
madepolo.comcom80020180
bacaindonesia.comcom1302320140
datedoktor.netnet1001720186
demirdemir.netnet100320181
personalizedink.comcom1502420140
mesinsaat.netnet90920182
brookfire.comcom901920130
atlasdenizcilik.comcom1552020180
urbanoise.comcom901820131
tempostudio.netnet1101520173
konyatoptan.comcom1102120180
tepecikkoyu.comcom110620181
totogrande.comcom100520180
totemgaming.comcom110620140
italymetro.comcom1001020150
filmsydney.comcom1001120160
rahatrahat.comcom100620150
yagistore.comcom90520170
modernhongkong.comcom140120180
jantespascher.comcom130120180
gezikocu.comcom802620160
lenssuyu.comcom80720170
parsenergy.netnet100120183
patikare.comcom830820180
zorluahsap.comcom1001120150
asesmart.comcom80320170
kasimachina.comcom1152120180
harpsarizona.comcom1223320130
salalacrosse.comcom1201420160
orleansvilla.comcom1242120130
rushkart.comcom803020180
simdimiami.comcom100120170
dereligrup.comcom1001320141
locaibiza.comcom90120140
ankaramarble.comcom125722120140
pizzatogo.orgorg907201623
ciritfisek.comcom100020130
sararegina.comcom100220171
kazienterprise.comcom1421220171
homerota.comcom802820140
purestrand.comcom100320180
etenderz.comcom82701720180
lakerdaci.comcom901320170
osmanliyapim.comcom1201620180
diyanetnamaz.comcom1222793720181
beerprotein.comcom110620170
istanbulsevda.comcom130520170
fatihunlu.netnet901820184
koroseal.netnet80520176
acmekart.comcom801220180
ademcoskun.comcom100720150
bolcaucuz.comcom90620160
idealhost.netnet9037201019
kedigolf.comcom80020180
lincolnpoker.comcom1203120070
nolapoker.comcom903020040
betonprefabrik.netnet141520182
ugraksobamangal.comcom1513420140
karapatterson.comcom130920080
basklink.comcom85302020140
baskaperon.comcom10794120150
agrijamaica.comcom110120151
alananna.comcom80420181
caddesatis.comcom1002820180
lojadomascote.comcom130020181
poyrazdagitim.comcom130120160
bulgaristanotel.comcom150020180
moodymarket.comcom1122220180
beergerman.comcom100420180
fenomenbayi.comcom110820162
muhasebeankara.comcom140920161
platochina.comcom101720180
haizione.comcom80520181
dagitimajans.comcom12511220180
amberstewart.orgorg1201920132
platinumresort.orgorg140520144
sayfapuan.orgorg90120141
stavangeropera.orgorg1401320071
adammandel.comcom1001520181
ajanders.comcom80820150
alinapak.comcom80620172
altarobot.comcom91120181
anitapizza.comcom101020100
azargarden.comcom100520130
bahisdurum.comcom100420170
balaenterprise.comcom140020180
balontasarim.comcom120120150
beachplumyoga.comcom130420140
bentleyhart.comcom110220180
bikinimission.comcom130120150
brandhumanist.comcom130220110
burhanguler.comcom110720170
canfieldpolice.comcom1401020100
canlinetice.comcom1101120110
chaddspizza.comcom1112620180
chinahongmudi.comcom130420150
elimarcos.comcom90120150
elmavera.comcom80120180
faitharena.comcom1002620101
fatihpilic.comcom101042220180
florafriday.comcom110220140
fotocenterindia.comcom1501120110
gallinaslibres.comcom142220152
generaldolce.comcom1251720150
ginamoon.comcom80320180
goldenstaravoca.comcom152620150
medinametro.comcom110120150
middleeastmetro.comcom150120150
hebaadel.comcom81520180
highfielddeer.comcom130120121
imzaaluminyum.comcom1301020151
medicalmetro.comcom123581320170
jackbats.comcom801020180
kibristapu.comcom100120180
koperform.comcom901920180
lakechelanbeer.comcom140120120
linkfors.comcom80020150
londonfont.comcom100120121
mamaplein.comcom90120131
mariaamin.comcom90120150
markamadrid.comcom1101220080
martiswift.comcom100120171
masaahsap.comcom901320180
mcgrathgolf.comcom1161220140
midialliance.comcom120020151
miraclebutik.comcom120420180
mountainlogos.comcom1321120110
mutluyapim.comcom1001820170
oliviamayo.comcom1001420130
albertomantelli.comcom150620161
floriadams.comcom100120160
kinavideo.comcom90620160
olimpiabura.comcom114620160
moragayrimenkul.netnet150020161
patronspot.comcom100020090
pazaristanbul.comcom1301520172
ahsapmasifmasa.comcom140320160
akvaryumkontrol.comcom150120160
annemaya.comcom80120160
craigotel.comcom90120160
doctordadi.comcom101920160
gozeeker.comcom801220160
kostumkomik.comcom110120160
magmadeal.comcom901020161
pastaunited.comcom110120160
tikatana.comcom80120160
viralure.comcom88620160
nationglobal.netnet120020161
dramamajor.orgorg100720162
fultongala.orgorg1001920161
starcombined.comcom120120160
turkotogar.comcom100120160
ucuzterminal.comcom120120160
americanblender.netnet150020161
rollingyogi.orgorg110320161
sayfapuan.netnet90020141
securitytalk.netnet12600529201810
gazeteyeninesil.comcom150020160
israfilyigit.comcom120020160
kulagarner.comcom100220160
pastanefis.comcom100020160
sametyuruk.comcom100120160
samsunkira.comcom100320160
taksimtesisat.comcom130020160
plumplatform.comcom120020180
halicbilisim.netnet120020141
avukatplaza.comcom110220180
arenasartstudio.comcom150020180
rentoneter.comcom100020180
inandanang.netnet100020182
konyatoptan.netnet110020180
songvolt.comcom822020180
lazymasti.comcom90020180
dortdort.netnet80020191
randevusual.comcom110020180
mustafalan.comcom1075352020181
saralatimer.comcom110020180
stajakademi.comcom110120171
aristore.netnet803320184
yokohamaramen.comcom1301120181
spotgrant.comcom90020180
erikberg.netnet80020148
virusward.comcom90120180
lakelandvilla.comcom1302020180
kirayuki.comcom80020180
aleniware.comcom90020180
agencypartner.netnet130820185
sayalink.comcom80920171
starringdallas.comcom140120170
vasilebec.comcom90120170
grandespot.comcom100120170
zarawilde.comcom90120170
munamana.netnet80020173
jasminepotter.comcom130020170
somaroyaloak.comcom120120170
adambasketball.comcom140120170
balebutler.comcom100120170
bornbeer.comcom818120170
firmalarareklam.comcom150520170
gozdeipekkose.comcom139120170
idealmalta.comcom100020170
ispartahayat.comcom120120170
lavastarmedia.comcom130120170
miamiokul.comcom90120170
miamiyasam.comcom100120170
miamiyenihayat.comcom140120170
parsvizyon.comcom100120170
stemmenhoorders.comcom150220170
stopdolores.comcom110120170
taninewyork.comcom11101320170
tuvakebap.comcom911620170
yatirimmiami.comcom120120170
yayanelektrik.comcom130120170
goldenproblem.netnet130020170
transferpers.netnet120020177
middlemania.orgorg112220171
studiogaliotto.comcom140220170
woodgreenmarket.comcom150120170
aciloksijen.netnet1101320170
teknikfren.netnet100020151
ulusalyangin.comcom124120171
sofabienhoa.comcom110120170
acayipinsan.comcom110120170
atlasaircharter.comcom150020170
istanbuleksper.comcom140020170
sertkayareklam.comcom140020170
sevketguzel.comcom110020170
safakgiyim.comcom1002420140
tuzeyapi.comcom80120170
tonyprim.comcom832120150
limongarcia.comcom110320170
fairmontgolf.netnet120220181
safaribaba.comcom100020180
elmagramekip.comcom120020180
pastapizzaplaza.comcom150120170
startama.comcom80220130
topaznetice.comcom110120110
vefatarim.comcom90020080
vegarapor.comcom90120140
volkaninal.comcom100120150
yogageorgia.comcom110420060
atcomail.netnet80020102
azeripoker.netnet100920110
kolimanya.netnet90120151
kotoglobal.netnet100020101
liderelektrik.netnet1301320080
mamaplein.netnet90020131
pacificsite.netnet110420083
saltanatinsaat.netnet140020150
tonyarena.netnet90020102
yedekservis.netnet110920081
yogaunity.netnet9011200511
betatomi.comcom80120180
sarapardocelaya.comcom150020180
britsense.comcom90020181
pizzagagny.comcom100020180
pizzaleraincy.comcom130020180
arenasbros.netnet100020181
cubayogaproject.orgorg150020180
afrikaspirit.comcom120020180
aslidenizacun.comcom1315020180
demiragency.comcom110720180
evetmania.comcom90020180
fiillage.comcom80020180
fotomaracanau.comcom130020180
kalecikiralik.comcom130020180
midyesatis.comcom101020180
simomarti.comcom90020180
sonucavar.comcom90020180
startimeagency.netnet140020182
asirlikkampus.comcom130020180
bendeisar.comcom90020180
breakingmala.comcom120020180
bridgerradon.comcom120020180
civiltank.comcom90020180
denizkokorec.comcom120020180
fourthmeta.comcom100020180
frenkpizza.comcom100020180
giveadambeer.comcom120020180
gorusunne.comcom910020180
hainanine.comcom90020180
hilalbeslenme.comcom130020180
houstonmineral.comcom140020180
kargoamazon.comcom110520180
kemerkebap.comcom100020180
koremacunu.comcom100220180
kuralfidan.comcom100020180
ladenyapimimari.comcom150020180
likitdemokrasi.comcom140020180
limelise.comcom80020180
maksatbanka.comcom110020180
mestregusto.comcom110020180
minakina.comcom80020180
minakonc.comcom80020180
ocakhali.comcom80020180
parketoptan.comcom110020180
parkevin.comcom83020180
polisakkarit.comcom120020180
portolafirewise.comcom150020180
radyosuzidil.comcom120020180
robotdang.comcom90020180
salahstream.comcom110020180
salonsanta.comcom100220180
storeforsolo.comcom120020181
tangirwilliams.comcom14325020180
tapirhost.comcom90020180
trengaming.comcom100020180
basakinan.netnet90020180
bendeisar.netnet90020180
takakoma.netnet80020180
ebetterstore.comcom120020180
generaltrenders.comcom150020180
holtekamp.comcom90020180
acilfikir.netnet90020181
coinrehber.netnet100020181
enginyigit.netnet100020180
giveadambeer.netnet120020180
equalitymarket.orgorg140020181
equalitymart.orgorg120020181
okeyallen.orgorg90020182
videomarketers.orgorg1400201811
ajansekip.comcom92020180
hurriyetdogan.comcom130020180
ovalmango.comcom90020180
partnerhukum.comcom12104120180
richermine.comcom100020182
lakelandvilla.netnet130020180
dapchiapas.orgorg100020180
portalankawall.orgorg140020182
selmabozkurt.orgorg120020181
richermine.netnet100020182
leekmine.comcom80020180
linkhainan.comcom100020180
luchengmail.comcom110020180
luchengmail.netnet110020180
lynndone.netnet80020181
alexyant.comcom80020180
artistgoto.comcom100020180
jamaicaincident.comcom150020180
baciroma.comcom80020180
dominantmask.comcom120020180
listestream.comcom110320180
bekaalma.comcom80020180
dudleyfrank.comcom110020180
naravalley.comcom100020180
unitykenya.comcom100420180
amandelice.comcom100020180
armaswords.orgorg100020181
seramania.orgorg90020181
discoverymama.comcom130020180
venusgardens.netnet120020182
fileorganik.comcom110020180
merkezpara.comcom100020180

Dün ve daha önceki günlerde düşen alan adlarını linkte bulabilirsiniz: Dün Düşen Domainler

Uzantı alan adlarını uzantı türüne göre bu bölümde görebilir ve tablo sıralamasını bu sütündan değiştirebilirsiniz. Eğer sadece COM uzantılı adresler ile ilgileniyorsanız aşağıdaki tabloda “Bul” kısmına “.COM” yazmanız halinde sadece bu uzantıya sahip adresleri görebilirsiniz. Sitemizde sadece önde gelen 3 uzantıya yer veriyoruz. Bu kısımda .NET ve .ORG uzantılarını da aynı yöntem ile listeleyebilirsiniz.

Uzunluk bu sütunda alan adlarını karakter sayısına göre küçükten büyüğe yada büyükten küçüğe doğru sıralandırabilirsiniz.

Backlink sayısı alan adının sahip olduğu toplam backlink sayısıdır. Maalesef internette düzgün çalışan API bulmak çok zor olduğu için bu verilerimiz güvenilir değildir. Eğer backlink değeri için alan adı alacaksanız lütfen kendiniz de adresi sorgulayınız. Tablomuzdaki veriler yüzde yüz doğru değildir bu sütunumuzda.

Archive sütununda adresin archive.org sitesinde yer alan kayıt sayısını görebilirsiniz. Domainin daha önce hangi kategorilerde ve aktif olarak yayın yapıp yapmadığına dair bu bölüm fikir vermektedir.

Son Kayıt sütununda adresin bilinen en eski kayıt tarihi yer almaktadır. Domainin geçmişi için önemli bir kriterdir.

Toplam Kayıt sütununda ise com, net, org gibi kaç farklı uzantısının kayıtlı olduğunu görebilirsiniz.


Satılık Alan Adları

Haftanı popüler webmaster forumları ve domain platformlarında devam eden açık arttırmaları ve hemen al fiyatlı satışlarını aşağıdaki listemizde bulabilirsiniz.

Listemiz sürekli güncellenecektir, alan adları ile ilgileniyorsanız lütfen yazımızı hafta boyunca takip edin !

Açık arttırmada olan alan adlarının isimlerine tıklayarak satışın yapıldığı sayfaya gidebilirsiniz.

İlgilendiğiniz Adresler İçin Linteki Bağlantıdan Bize Ulaşabilirsiniz: Domain Satış

DomainKategoriFirmaKayıtBitiş
hiyeroglif.comJenerikNameBright20162020
kofa.netCVCVGodaddy19982020
sosyaluzman.comWebmasterNamebright20182020
sosyalasistan.comWebmasterIonos20192020
iletisim.orgGenelGodaddy20012020
kocaelihaber.orgHaberGodaddy20072020
etkinhaber.comHaberNamebright20072020
ressam.netGenelGodaddy20022020
beyler.netGenelGodaddy20002020
firmalar.orgE-TicaretGodaddy20062020
mp3indir.orgGenelGodaddy20032020
guzelseo.comWebmasterGodaddy20192020
ucretsiztema.comWebmasterNamebright20192020
seoscore.netWebmasterGodaddy20172020
adanaliyik.comGenelNamebright20152020
muhi.netCVCVHostingcomtr20192020
pezu.netCVCVNamesilo20192020
vohe.netCVCVHostingcomtr20192020
levu.netCVCVHostingcomtr20192020
kevu.netCVCVHostingcomtr20192020
luhi.netCVCVHostingcomtr20192020
gihu.netCVCVGodaddy20192021
pevu.netCVCVHostingcomtr20192020
gundem724.comHaberGodaddy20192020
mangir.netCoinHostgator20172019
zerzevat.netGenelGodaddy20112019
gorselarama.comGenelGodaddy20182019
gorselbilgi.comGenelGodaddy20192020
aranmahacmi.comWebmasterGodaddy20192020
ozgunyazi.comGenelGodaddy20192020
bagcilar.coİlçeGodaddy20192020
gaziosmanpasa.coİlçeGodaddy20192020
sariyer.coİlçeGodaddy20192020
kagithane.coİlçeGodaddy20192020
catalca.coİlçeGodaddy20192020
buyukcekmece.coİlçeGodaddy20192020
gungoren.coİlçeGodaddy20192020