06 Eylül 2019 Cuma düşen domain (alan adı) listelerini yazımızın devamında bulabilirsiniz.

Domainlerin düşeceği gün, en geç saat 17.00-18.00 saat aralığında günün listesi sitemize eklenmektedir.

Facebook’ta Takip Et, Listeler Eklendikçe Haberin Olsun: https://www.facebook.com/isimyakala/


Domainler Ne Zaman Saat Kaçta Düşecekler?

Alan adıları yıllık olarak satın alınmaktadır ve eski sahipleri tarafından yenilenmediklerinde boşa düşerek tekrar satın alınabilir hale gelirler.

Farklı uzantılara sahip alan adlarının bugün akşam hangi saat araşığında düşeceğini linkteki yazımızda görebilirsiniz. En çok takip edilen .COM ve .NET uzantılar akşamları saat 20.30’dan sonra düşmeye başlamaktadır. Aşağıdaki listelerdeki alan adları bugün akşam düşecektir henüz düşmemiştir ! Detaylı bilgi için: Domainler Ne Zaman Boşa Düşer

06 Eylül Düşecek Domainler Listesi

Aşağıdaki listedeki bul kısmına bilgi, sağlık, araba, haber, tekno, ekonomi, kadin, indir, tatil, emlak, bilet, kripto, sohbet, yemek, bebek, kitap, hediye, moda, oyun, sigorta, kredi, indir gibi kelimeleri yazarak sadece o kelimenin geçtiği alan adlarını görebilirsiniz.

DomainUzantıUzunlukBacklinkArchiveSon KayıtToplam Kayıt
habergo.comcom7190720820090
amazonoyun.comcom10119627720080
bilgisonsuz.comcom1122768220080
trafikbilgisi.comcom1302720181
detaybilgisayar.comcom15611420182
arsuzemlak.comcom1001520092
milashaberleri.comcom1404020150
e-sohbet.comcom802220180
sanatsalhediye.comcom1404420140
sarsukoyun.comcom1026420180
counterstrikeindir.comcom1802920180
deha-emlak.comcom1001120180
oyunbahis.comcom911520170
bilgidagarcigi.comcom14109820180
pamiremlak.comcom1001420180
arabamnerede.netnet1278420081
biretemlak.orgorg106710420091
yuvamemlak.orgorg1033620174
butikkitap.comcom100220110
sohbetvadisi.comcom1202620131
yenioyunevi.comcom11122645220100
arnavutkoybilgisayar.comcom200920180
kindir.netnet62882829620092
sanaloyuncu.netnet1164120171
atasoyemlak.netnet110920181
hediyelikpastalar.comcom1711120140
birsenemlak.comcom110420180
uzmanfirmalar.comcom130920180
haoyungouwu.comcom110020160
sakarya-emlak.comcom1304420120
indirimdemi.comcom1101320180
teknodns.comcom80220180
ultratatil.netnet100120181
oyuncakayi.netnet1001220181
torbalihaber.comcom1201520180
kitapall.comcom802120122
arnavutkoybilgisayarservisi.comcom270820180
bombahaber.netnet1010213820181
yeditepeemlak.netnet1321920172
gelecekteknoloji.netnet160320181
biletucak.comcom912820180
ertugsigortacilik.comcom17213320120
indirimyolu.comcom1101020180
markhaberstock.comcom1411020171
boluarabakiralama.comcom1702020120
enucuzsigortaci.comcom1501620181
osmanogluemlak.comcom1401220181
oyunfix.comcom703520180
sebnememlak.comcom1101120160
teknoliman.comcom101920180
06baskentemlak.comcom1402920110
54emlak54.comcom902220180
habershamschool.comcom1501120180
ednaguzman.comcom1001120140
haberaninda.comcom1111620180
egeteknosis.comcom11727520170
habergoynuk.comcom1111020180
kalmeemlak.netnet100620180
busigorta.comcom90120181
oyunanahtari.comcom120020180
sooyunyun.comcom9563020180
kalbimsohbet.comcom1212420172
haberlerden.netnet112420181
bebekkombin.comcom1101420150
eskisehiryemeksiparisi.comcom2231720170
indirimyolu.orgorg110020180
bebekb.comcom60220130
beydillisigorta.comcom1502520181
canakkaleatabeyemlak.comcom2011620170
dizioyuncular.comcom135720180
elitemlakduzce.comcom1401820120
evimburdaemlak.comcom1423820150
modernemlakacibadem.comcom1901320120
sodoyun.comcom71020170
oyuncakiskelesi.comcom150020130
dmcemlak.netnet80020161
herdaimbilet.comcom120220160
slidindirtyschenectady.comcom220120160
kredibleshotya.comcom140320160
dilekemlakinsaat.netnet160020160
houstonhaber.comcom120020160
newjerseyhaber.comcom140020160
sogukcesme-emlak.comcom1613220160
ulaktanhaber.comcom120020180
sirketkredisi.comcom1305520150
sultanemlak17.netnet130020180
antalyahilalemlak.comcom1713820170
taoyunshop1.comcom110020180
kandisliebhaber.comcom151020170
kriptozade.comcom101420170
tiemlak.comcom70820170
kriptozade.netnet101020170
guvenevemlak.netnet121120171
akaremlak.orgorg91120172
habergevas.orgorg101020170
bebekkehribar.comcom131120170
bebekveyatak.comcom120020170
burunuzmani.comcom110020170
emaemlakgolcuk.comcom141120170
erzurumsporhaber.comcom160020170
mordoganardicemlak.comcom181220171
raporbilgi.comcom101020170
yasalsigorta.comcom120020170
yasalsigorta.netnet120020170
kriptofoto.comcom1011320170
kriptocoinz.comcom110220180
kriptokoinz.comcom110220180
taraftarbileti.comcom140120140
zorbeyinsaatemlak.comcom1702820120
hediyem.netnet7021200212
yunanistandatatil.netnet171020171
bayrakemlakturgutlu.comcom190020180
bilginemlakniksar.comcom170020180
habergurbetci.comcom130020180
harian-tekno.comcom120020180
hayatemlakantalya.comcom170020180
kabalogluemlakveinsaat.comcom220020180
kent2emlak.comcom100020180
maggieshabersham.comcom160020180
nebiemlak.comcom90020180
ozguminsaatemlakelektrik.comcom240020180
ozsenainsaatemlak.comcom170020180
suemlakgungoren.comcom150020180
yukselemlakkapakli.comcom180020180
arakangroupemlak.comcom160020180
imrenilesibilgiler.comcom181820180
iskenderunnuremlak.comcom180020180
magazamislady.comcom130020180
meiguoyunchan.comcom130020180
oyunevrimi.comcom100020180
tamkorumasigorta.comcom160020180
teknolow.comcom80020180
teogenteknoloji.comcom150020180
trilogitekno.comcom121020180
yogamagazasi.comcom121320180
sohbet-egel.comcom110020180
vdindir.comcom78481220180
esohaber.netnet80420182
indirimyolu.netnet110020180
bahis-oyunlari.orgorg140020180
bedavaslotoyunlar.orgorg170020180
byahsapoyuncak.comcom140020180
canlihatsohbet1m.comcom160020180
idemiremlak.comcom110020180
kktcemlaksayfasi.comcom160020180
mirledteknoloji.comcom150020180
sunaemlakizmir.comcom140020180
tuatarabaseball.comcom150020180
uzmanicevapliyor.comcom160020180
uzmanfirmalar.netnet130020180
teknolojikoleji.orgorg150020181
didimtatilevimapartev.comcom210020180
isubem-yapikredi.netnet160020180
edevletbilgi.orgorg120020180
kredilen.netnet80020181
karimemlak.comcom100020180
oyuncununhaberi.comcom152420180
aksigortastartupchallange.comcom250020190
nethocam.comcom847720150
oto42.comcom5129620180
gokhanisik.comcom100220180
umraniyeboschservisi.comcom2011320171
likeandlike.comcom1103420182
karabulutdekorasyon.comcom1981020170
radioenglishtime.comcom16123913420060
nazmodaevi.comcom1012511720070
kirdugunleri.comcom120720120
payidarinsaat.comcom1301220180
korfezdernegi.comcom138320120
neselitatlar.comcom1222220170
uzatan.comcom60420180
seslidunyam.comcom11263220131
sivereksehri.comcom12132120120
wowtopkapi.comcom1042820010
anadolukuyumcusu.comcom1603120080
ultimatecodebank.comcom16173620150
demamimarlik.comcom122520170
afyonilan.comcom902020110
kobininsesi.comcom11151520150
purhayal.comcom80020180
seri-sonu.comcom92820140
netisi.netnet613320175
landroverankara.netnet150420160
audia5.netnet6416201411
volkswagenjetta.netnet15144220146
netgazetesi.netnet112529920131
sehitler.netnet813120114
blogkrali.netnet902120131
mugladergisi.comcom120420180
imajclup.comcom80120180
amerikadaucuz.comcom1302120160
bizimhaliyikama.comcom1533820103
tutuklu.comcom729817120101
purhayal.netnet80020180
umutsuzlar.comcom100520180
yunusartan.comcom1003020100
enyenisarkilar.netnet1437920171
baycografya.comcom1182620100
offroadmodifiye.comcom151120170
djdomino.netnet821220162
mutfakperde.comcom110820180
volkswagenpassat.netnet16031201410
arcelikumraniyeservisi.comcom2211820170
ufukayazmimarlik.comcom1601420180
volkswagencc.netnet1251920147
vanmercanmobilya.comcom160620120
rabiahatun.comcom100020180
zekisapka.comcom901820100
ahsapfabrikasi.comcom140220181
hemenotoyedekparca.comcom1802320180
eniyiokul.netnet90220183
herbalifeantalya.netnet160020180
e-korse.comcom701920160
pertonline.comcom1002420140
diziya.comcom602120130
noktamuzik.comcom1062620160
audia9.netnet611320146
akademikkadro.comcom1325220130
toptaneldiven.comcom131720171
ibrahimsahinn.comcom130520180
umraniyesurucukurslari.comcom221605220140
kapadokyanatureland.comcom1921720130
okulkonferanskoltugu.comcom20161320180
egeted.comcom602620160
travertineturkey.comcom1601120180
volvov40.netnet811220149
kiario.netnet6019201415
e-sogutmaci.comcom1111920170
bursadaperde.comcom1201220180
hostmakinasi.comcom121320170
banabisor.comcom90520180
adnanakgoz.comcom100120160
katretelekom.comcom1204520111
ghostsro.comcom80720180
bigailan.comcom802020180
mersingitarkurslari.comcom1903320150
kocaelidizayn.comcom130020180
hizlimotorkurye.comcom150120160
minsuite.comcom80020181
harddiskdolum.netnet1325420162
torbaci.comcom706120140
samsunyapidekorasyon.comcom200220180
tugruldogan.comcom110620180
erterinsaat.comcom1112120170
erkenbosaliyorumtedavisi.comcom240320180
ukabagro.comcom812120170
parfumolog.comcom100020180
lezafet.comcom721320130
tradengineer.comcom1201320180
check-deal.comcom102620171
prefabrikevlermugla.comcom19396520130
turk-o.comcom6342220100
kamerunvizesi.comcom1301920130
kulturplatformu.comcom1574120140
yigitlerelektronik.comcom18104220130
salonperde.comcom100120180
ucuzperdeal.comcom110020180
bereketduasi.netnet122167720153
imalattanperde.comcom142420180
dtspareparts.comcom1277020180
wowkremlin.comcom10161820010
suadiyeelektrikci.comcom170120180
e-nabiz.comcom744620181
mobilvekil.comcom100220180
modamilla.comcom90020180
kobihizmetleri.netnet141020171
gezerelektrikmuhendislik.comcom2411320170
allimaj.comcom70020180
nevzatozel.netnet100020161
afusgayrimenkul.comcom150220140
anigida.comcom70520180
aquababiesturkiye.comcom17612620180
araspare.comcom80120140
asilyonetim.comcom111220170
atbmedya.comcom80020180
aycanakdogan.comcom1201020140
bahadirodabas.comcom130320150
bozokmetal.comcom102820110
buyukreel.comcom90620130
canagirkaya.comcom1101220180
ereglimgazetesi.comcom151020170
egitimtakipsistemi.comcom180220180
ekicigranit.comcom111420181
emg-as.comcom60120140
eniyiperdeci.comcom120220180
erolcitci.comcom911820130
ersensari.comcom90020151
faturaodemenoktam.comcom170020180
fondplan.comcom80520110
gardobebis.comcom1004220150
imajbistrocafe.comcom1431420140
azimeabla.comcom90220180
azimeablaninyeri.comcom160120180
azimeabla.netnet90320180
azimeablaninyeri.netnet160320180
karotcuankarada.comcom1501920140
kayseri-otokiralama.comcom1922420110
kimyakonulari.comcom1301020150
merttalay.comcom921420140
nacrelif.comcom80020150
ncrklima.comcom801020110
noniki.comcom61120170
ottoban.comcom702020100
e-nabiz.netnet70020181
gezginlogo.comcom100020180
adasarisoy.comcom1001720160
ankaramekanik.comcom130720160
cadircimuhendislik.comcom180120160
dubaidanisma.comcom120220160
egetmf.comcom6801220160
egiyimsepeti.comcom1201020160
elazigotoeksper.comcom150120160
floriapansiyon.comcom143320160
ilginoto.comcom80220160
kalemterapi.comcom110920160
kizginelinsaat.comcom1401720160
otoekspertizelazig.comcom180120160
parkvistabursa.comcom140020160
rdltekstil.comcom100620160
serkankenanoglu.comcom150120160
simsanalkontor.comcom1401320160
tefalservisankara.comcom170120160
tefalserviscankaya.comcom180220160
zetoryedekparca.comcom150220160
zeynepozelegitim.comcom160120160
avrupapanel.netnet110620161
ilanyazilim.netnet110320161
hizmettin.comcom90020180
printselfy.comcom1001220180
evdenevenakliyatyenimahalle.comcom270020110
yakalaexpress.comcom137421220140
toptanmedikalmalzeme.comcom2011820170
gaziantepavukatrehberi.comcom220620180
perdechi.comcom80120180
whfol.netnet51020170
gaffamusic.comcom1001620180
bursakoltuktamircisi.netnet2017020180
dirilisayakkabi.comcom1501420180
turkiyeherbalife.netnet160020180
ambalajfirmalariistanbul.comcom2442220170
bahcesehirotoanahtar.comcom201320170
binbircesitmarketim.comcom191320170
check-lead.comcom101120170
cimpapeyzaj.comcom1121820170
dilaraisikli.comcom121420170
elifprensesgelinlik.comcom1927320170
elsinatip.comcom961220170
enstrumanimalat.comcom153620170
envimob.comcom7191420171
ey-teknik.comcom91220170
gamzedolls.comcom101120170
gazetedinamit.comcom131220170
ilkizlerim.comcom101120170
itadilegitimi.comcom1311820170
kazimyucel.comcom1011020171
kuafortoptanim.comcom141320170
mutlulugunkanatlari.comcom1911720170
myyumurta.comcom90120170
nitriliseldivenitoptan.comcom221120170
ozgurgaraj.comcom101120170
sanliurfaevdenevenakliyatfirmalari.comcom341920170
sd-gayrimenkul.comcom141920170
turkuazgaleri.comcom1311320170
zeysway.comcom71120170
bhcbetonelemanlari.netnet181420170
ciceknakliye.netnet121020171
deriis.netnet61020172
ercaginsaat.netnet111020171
gebzecevirimerkezi.netnet181020171
vizehatti.netnet91020170
volkswagencaddy.netnet15116620144
reklamlayan.comcom110520100
yamansson.comcom90120110
ynesil.comcom60120110
cepzilla.netnet80020101
citroenc-elysee.netnet150620140
seri-sonu.netnet90020140
adlisg.comcom60120180
ajanshub.comcom80020181
aktasdigital.comcom1226020180
alasehirekspertiz.comcom1701420180
aldaayakkabicilik.comcom170120180
ankaradacati.comcom1201620180
arifcell.comcom80020180
arnavutkoykamera.comcom160020180
auroraoudstrings.comcom160020180
avfirat.comcom70020180
ayakstil.comcom80020180
aydinpizzapizza.comcom157920180
baharrhali.comcom100220180
bastacimhaliyikama.comcom180020180
baynurmedikal.comcom130020180
bestmakeupdiy.comcom130020180
bigmammascengelkoy.comcom180020180
bigmammasnatoyolu.comcom170020180
biucus.comcom60020180
cesssaglikhizmetleri.comcom200020180
ceyizlikperde.comcom130020180
cocukodasiperde.comcom150020180
concrart.comcom80020180
dayiburger.comcom100020180
debatekstil.comcom111020180
decorandlife.comcom12303720180
demirorensanayi.comcom150020180
demirorenturizm.comcom150020180
dizifilmyorumlari.comcom172020180
dizivefilmtavsiyeleri.comcom212020180
doktorimece.comcom110020180
e-yoncamed.comcom100020180
egeaturkradyo.comcom130620180
elaziggunlukdaire.comcom171020180
elifnurdilme.comcom120020180
eminonusabun.comcom120020180
enpopulerdiziler.comcom162020180
enpopulerfilmler.comcom162020180
eryamandakidershaneler.comcom220020180
eryamandershanefiyatlari.comcom240020180
eryamandershaneler.comcom180020180
eryamandershaneleri.comcom190020180
eryamandershanesi.comcom170020180
eyoncamed.comcom90020180
fas-food.comcom80020180
getawaytur.comcom100020180
gokturkvinc.comcom110720180
gokturkvincantalya.comcom180020180
gucmanlarotomotiv.comcom170020180
haftalikkazan.comcom130020180
hayalevimzuccaciye.comcom180020180
hayatcekilis.comcom120020180
haydiphukete.comcom120020180
incegerdan.comcom100320180
incemetre.comcom90020181
incetaskaplama.comcom140020180
instagramidtv.comcom130020180
istanbulliderhaliyikama.comcom230020180
kal93.comcom51420180
kaleturbojet.comcom120020180
kalvens.comcom70020180
kanaryaninpesinde.comcom170020180
kapakliimarbarisi.comcom170020180
kocpakambalaj.comcom130220180
konyatesisatustasi.comcom180020180
kuaforcelik.comcom110020180
kullanipat.comcom100020180
lagunestone.comcom110020180
leoluxyonetim.comcom1301120180
manavgatsoruyor.comcom150020180
masallarlakahkahaterapi.comcom230020180
medyumcindar.comcom120020181
mertyildirimm.comcom130020180
mini-ugv.comcom80920180
miniklerkampusukres.comcom190020180
modaberceste.comcom120020180
modapayidar.comcom110020180
naturalalmondsugar.comcom180020180
ozelpartnerler.comcom140120180
parfumoloji.comcom110020180
petpalacevet.comcom120820180
recepkayamedya.comcom140020180
sanatlaogretenanaokulu.comcom220020180
sanliurfaimarbarisi.comcom190120180
sarkhansabun.comcom120020180
seftaze.comcom70020180
seltemkagit.comcom110220180
sevimlinakliyat.comcom150020180
sinehonk.comcom80020180
tekin-vinc.comcom100120180
toekinsaat.comcom100020180
tourballons.comcom110020180
toursballoon.comcom120020180
trendxgo.comcom80020180
uberevdenevenakliyat.comcom200320180
universalhumanhealth.comcom200020180
venusgrafik.comcom110020180
yaprakkartoncanta.comcom170020180
yatakodasiperde.comcom150020180
yekfit.comcom60020180
zeyrat.comcom60020180
abayinsaat.netnet100120181
ajanshub.netnet80020181
alyildiz.netnet80020182
artalanya.netnet90020181
dizifilmyorumlari.netnet170020180
duvarsanati.netnet110020181
enterili.netnet80020184
fsmtip.netnet60020181
gokturkvinc.netnet110020180
gokturkvincantalya.netnet180720180
greenparkbodrum.netnet150020180
hizmettin.netnet90020180
husnukelam.netnet100020180
kerevis.netnet70020180
libpacket.netnet90020180
librudp.netnet70020180
libsocket.netnet90020181
libthread.netnet90020180
mobilvekil.netnet100020180
seftaze.netnet70020180
studioculinary.netnet148020181
taurise.netnet70220184
vefagumruk.netnet100020181
yapikayitbelgesial.netnet180020180
gucuhisset.netnet100020181
maxmaneczane.netnet121220180
modamilla.netnet90020180
tradengineer.netnet120020180
aapilates.comcom91820172
ikraakademi.comcom110020132
ifdizayn.netnet80020181
ortuteks.netnet80020180
fenerbahceofficial.netnet180020180
etiketkurdu.netnet110020180
3byazicimerkezi.netnet150020180
turizmmall.comcom100020180
specialpigeon.comcom130020180
solmaz2tekelshop.comcom16142020180
simtesmekatronik.comcom160020180
sevyapmuhendislik.comcom170020180
pecetemuctu.comcom110020180
orhanbabaninciftiligi.comcom210020180
nixmel.comcom60020180
micamu.comcom60020180
menlosmobilya.comcom130020180
kutsalzaman.comcom110020180
ikincielnotebookservisi.comcom230020180
hamidiyeairport.comcom150020180
gk-hukuk.comcom80020180
fenerbahceofficial.comcom180020180
evindizayni.comcom112816020180
ecemgursel.comcom100020180
dijitalguven.comcom120020180
batifinans.comcom100120180
aygulbeton.comcom100020180
aktifmermergranit.comcom170020180
3byazicimerkezi.comcom150020180
ucuncumatbaacilar.comcom170020140
ucinarbasaran.comcom130620130
elmasdokummakina.comcom161720170
specialpigeons.comcom140020180
etiketkurdu.comcom110020180
iletinet.comcom80120180
ulusoycollection.comcom1603520160
biturla.comcom704620160
yarnend.comcom70020180
ikraacademy.comcom11453220130
askisems.comcom80020180
mahzenistanbul.comcom1451520180
bireyselyatirim.comcom1532620160
albahralaswad.comcom1301320180
neyapilmali.comcom11834320140
hukukimutalaa.comcom130820180
rotaistanbul.comcom1202120180
prostmed.comcom80220180
biricikmobilya.comcom1424820180
onlinebilirkisi.comcom150120180
elgtrade.comcom83320170
bubizimhikayemiz.comcom160020180
4box.netnet41065201725
asimport.netnet80120187
clickbtc.netnet80020186
seviyo.netnet677120184
optimalservis.comcom130020183
marycase.netnet80020143
adaelektrik.netnet111583220183
comeright.netnet93320183
daikinservisi.netnet1301920183
pdfkutuphane.netnet122360332320182
ozankaraca.netnet100020182
sesinceltme.netnet110020172
tembelogrenci.netnet130220162
pelitgayrimenkul.comcom1613220172
e-feribot.comcom90020132
bellamin.netnet88020182
dogugayrimenkul.netnet1553920102
dogantesisat.comcom120020182
tezhazirlamaofisi.netnet170020181
termalcamur.netnet110020181
netiztv.netnet70020181
kepcevideolari.netnet140020181
eyupsultanhacamat.netnet170020181
brkcn.netnet50020181
babyfors.netnet80020181
tolgaaydemir.comcom120020181
guvenlikfilesiankara.netnet200020181
elegancegumus.comcom130020181
mesaleendustriyelmutfak.netnet230020171
mesaleendustriyel.netnet170020171
spsautomotive.comcom130020181
boomerang-tech.comcom140020181
techwalia.comcom90820181
oncugiyim.comcom90020181
mersinmermer.netnet124020181
becttrend.comcom934020141
barisdemirel.netnet120620181
evimm.netnet5553220181
diyetpaketim.comcom120020181
trafikteyim.netnet11868920141
mermersilim.comcom1101220141
mertajans.netnet902320181
paslanmazizgara.netnet1531520131
paslanmazkanopi.netnet1532620131
apcpaslanmazkorkuluk.netnet204820131
nilufergayrimenkul.netnet180620181
aslancelikkapi.netnet140220181
saatin.comcom602320171
subayi.netnet60620171
adayay.comcom60320181
boygar.netnet60020181
anindayukle.comcom1183420181
saglikgezegeni.comcom1401920181
laptopkiralama.netnet140220181
yazilimakademi.netnet140620181
patenci.netnet70620181
pembedomates.comcom1211320061
pembedomates.netnet1201120061
emhas.comcom501120141
kalenderli.comcom100620171
altayform.comcom926620061
resitalorganizasyon.netnet190120180
hemopex.netnet70020180
elbirligisistemi.netnet160020180
dogankaraoglu.netnet130020180
264cicek.netnet80020180
zuhalkarakocdora.comcom160020180
yediisi.comcom715300020180
uyducuadana.comcom110020180
totemdekorayson.comcom150020180
taksimperde.comcom110020180
sporlot.comcom70020180
sinirsiztvizle.comcom140320180
sineklikkonya.comcom130020180
shinningeyespads.comcom160920180
sepicienerji.comcom120020180
sandwichzade.comcom1241520180
sakaryamakinaimalatcilari.comcom250020180
sakaryamachinerymanufacturers.comcom290020180
sakaryamachinery.comcom160020180
sakaryamachine.comcom140020180
sakarya-makine.comcom140020180
sakarya-makina.comcom140020180
poftirik.comcom82020180
plazayilmaz.comcom110020180
peletburda.comcom100020180
ozcanozelservis.comcom150020180
otostartstop.comcom120020180
onurcatering.comcom120220180
omurmed.comcom70020180
omersercanipekcioglu.comcom200020180
nargileciadam.comcom130820180
muhammetcipil.comcom130020180
modsandroid.comcom1127120180
meytemizlik.comcom110020180
mehmetsalihyurumekistiyor.comcom250020180
marjinaltrakya.comcom140020180
magazinelbakis.comcom140020180
lonacoffeeandmore.comcom170720180
letsblanc.comcom90020180
kocunusec.comcom90020180
kepenklazim.comcom110020180
kayraatekstil.comcom130020180
karadagkiralikarac.comcom180020180
kadinasorduk.comcom1251020180
justgameitt.comcom110020180
internetbasvurusuolustur.comcom240020180
instagramfirmatanitimi.comcom220120180
herokimya.comcom90020180
herbalileformdasin.comcom180020180
hemopex.comcom70020180
havuzumakimyasal.comcom160020180
hairarabclinics.comcom150020180
gokceadabalciftligi.comcom190020180
gknyldrmm.comcom90020180
ftnsgaming.comcom100020180
filminginist.comcom120020180
filebere.comcom80020180
evdenmuhasebe.comcom130020180
embulutlar.comcom100020180
ekoltezmerkezi.comcom140020180
dropshipps.comcom100020180
dogalpazarsepetim.comcom170020180
doceia.comcom60020180
cilingirciadana.comcom150020180
ciftelcambalkon.comcom151020180
canlibahis11.comcom120020180
burkaydin.comcom90020180
boomerangenergies.comcom170020180
boomerangbiomass.comcom160020180
boomerangbiogas.comcom150020180
biotec-turkiye.comcom140620180
belmak-makina.comcom130720180
balooncuu.comcom90020180
bakimsart.comcom90020180
ayerexport.comcom100020180
arc-garaj.comcom90020180
aquaplusguzellikmerkezi.comcom230020180
ankaradijitalforma.comcom180020180
altspor.comcom70020180
alosgardenkemer.comcom150020180
ajansgibi.comcom90020180
abyarproject.comcom120020180
90fitdergi.comcom100420180
3pati1patik.comcom110020180
renadanismanlik.netnet150020180
minedogsnw.netnet102320180
zeminbulusmalari.comcom160020180
yurtap.comcom60020180
yigitkumlama.comcom120020180
wisedudeproduction.comcom180020180
ugursezginer.comcom120020180
twobmedical.comcom110020180
tugayuner.comcom90020180
trakyarumeligazetesi.comcom200020180
tgrtsevenler.comcom120020180
tendenobuvki.comcom120120180
tekneolojitv.comcom120020180
suhedagida.comcom103320180
studiosonra.comcom110020180
spectrachangeconsulting.comcom230020180
spectrachangeconsultants.comcom240020180
spectrachange.comcom130020180
sonracretions.comcom130020180
sonracretion.comcom120020180
sirvankolan.comcom110020180
sirintunca.comcom100020180
salonfrezya.comcom110020180
pingoist.comcom80020180
parakodu.comcom80020180
ozarotoservis.comcom130020180
osman-yigit.comcom110020180
orhanerdol.comcom100020180
nostaljiconconcraft.comcom190020180
nebitaskan.comcom100020180
mucahidcelik.comcom120020180
movelkozmetik.comcom130020180
mobilsevfm.comcom102020180
mirackonteyner.comcom140020180
mersinmermerci.comcom140020180
medyumarchil.comcom120020180
malatyateamlasertag.comcom190020180
malatyakocamanhaliyikama.comcom240020180
lukmedikal.comcom100020180
leviholding.comcom110020180
kuruyemiscenneti.comcom160020180
kucukgecitkoyu.comcom140020180
kodcuhoca.comcom90020180
kerimcivatahirdavat.comcom1901820180
karakoyelektromarket.comcom200020180
karadeniztesisatelektrik.comcom240020180
kaanotokurtarici.comcom160020180
ispartacimnastik.comcom160020180
hizmetpanelim.comcom131820180
help-instagramverify.comcom200020180
hamityay.comcom80020180
hadifilme.comcom914420180
habnetland.comcom100020180
guvercintavuk.comcom130020180
gardmt2.comcom71020180
gabartaypeyzaj.comcom140620180
expresstok.comcom101420180
eurohesaplama.comcom132587020180
erhan-dusunceli.comcom150020180
engineercat.comcom110020180
egesunenergy.comcom120020180
dorukmentesinsaat.comcom170020180
demobeyin.comcom90120180
deltadesignatelier.comcom180020180
definegrupdedektor.comcom180620180
cokguzelolacagiz.comcom160020180
cilekko.comcom70020180
canliskorboard.comcom140020180
bursakedimamasi.comcom150020180
bozokdemirtek.comcom130020180
bozkurtarea.comcom110020180
bloodyunity.comcom110020180
bilalkurban.comcom110020180
bigapeynirhelvasi.comcom170020180
bestplayiogames.comcom152020180
bayicin.comcom701720180
aymaksoft.comcom90020180
avelsamt2.comcom90020180
atolyekeyfisefa.comcom150020180
askalelim.comcom90820180
antalyaiskanalma.comcom160020180
alperdnz.comcom80020180
allaboutkg.comcom100120180
alanyaotokurtarici.comcom180120180
alanyaotocekici.comcom1511120180
akaliso.comcom70020180
adaletbasdas.comcom120020180
55yapi.comcom60020180
3khobi.comcom60020180
1e1bpm.comcom60020180
ucgunlukdunya.netnet130220120
cediyez.netnet70420140
zelsatextile.comcom1202120120
veloturka.comcom90120140
ucuzkaroser.comcom110120130
tandeniz.comcom80120140
restorandan.comcom110020100
veyselaybakan.comcom130020180
onetarz.netnet70020170
nzlfile.netnet70020170
koleksiyonvakfi.netnet150020170
koleksiyonfoundation.netnet200020170
akisdialog.netnet100020170
yeninesililaclama.comcom170220170
yasemintirpan.comcom130020170
viatoremtour.comcom120020170
trendduragi.comcom1127780871620170
trafinetworkksads.comcom170020170
studio13istanbul.comcom160420170
sqrakademi.comcom100120170
shinyturkiye.comcom120020170
shinyturkey.comcom110020170
rubiconantislip.comcom1501120170
rfnrcrm.comcom70020170
radyomoji.comcom90120170
pozisyonpenalti.comcom1501420170
portvent.comcom80220170
nzlfile.comcom70120170
modaerma.comcom83320170
maygruppolimer.comcom140220170
koleksiyonvakfi.comcom150020170
koleksiyonfoundation.comcom200020170
iuniversitem.comcom121020170
isuyusmazliklari.comcom160820170
is-mahkemesi.comcom120320170
globalperspectif.comcom161320170
ferhatilesirinler.comcom170020170
erikbahcesi.comcom1101920170
demlinotalar.comcom1211920170
akisdialog.comcom100020170
ahmettekinhoca.comcom1461520170
1yasin.comcom60020170
12altinisikdna.comcom1401820170
defnemdavetiye.comcom1401220180
livadihafriyat.comcom140220180
basari25.comcom80220180
cycolog.comcom70020180
koctemhaliyikama.comcom16172920170
boomerang-technology.comcom200320180
tuncaicmimarlik.comcom150720180
lopusbilisimcozumleri.comcom21871920180
herbalfitbeslen.comcom152020180
360fotografcekimi.comcom170020180
cumhuriyetmuhafizlari.comcom210120180
sivilhavacilikkulubu.comcom200220180
zemrupark.comcom90120160
zagoroutdoor.comcom120120160
ysyklimadunyasi.comcom150120160
yangintupuaskiaparati.comcom2102220160
quinoaexchange.comcom140020160
promitprofil.comcom122337120160
onurtanaltay.comcom120020160
marksanenc.comcom100320160
kahramaninsaatayrancilar.comcom2401320160
erzurumyurtlari.comcom1592820160
erzincanbakirevi.comcom160220160
eestiseo.comcom80120160
e-mimplastik.comcom1211920160
beykozcnc.comcom90520160
bandirmaozeldireksiyondersi.comcom2701620160
antalyaklimabakimservisi.comcom248320160
adaferayapi.comcom110020160
adafera.comcom70020160
gunaybey.comcom80020180
tamircimibul.comcom120020180
ozhaciogullari.comcom140120130
orbaylarmakina.comcom14221020130
odunatolye.comcom100020180
nedemisler.comcom100620180
mosaiccavesuites.comcom160020140
marycasehome.comcom120020140
lokantadan.comcom100020100
kochortumhirdavat.comcom1702720120
keyenerjiinsaat.comcom150220130
antalyatransfertaksi.comcom200020170
igelio.comcom60020170
huryurekliler.comcom132220180
horonmerkezi.comcom120520110
afzmimarlik.comcom110520170
gencek.comcom60720100
evtamir.comcom70020180
entemizi.comcom80220100
durumsokagi.comcom113820180
dorukmentes.comcom110220180
dogalinial.comcom100020180
datamikurtar.comcom120020180
buzpatenci.comcom100020180
bisikletforma.comcom130420120
binasiteyonetimi.comcom1601020170
besteguner.comcom100120170
bantmarketi.comcom1101320180
aspiratorhavalandirma.comcom210520180
arsivpaylasim.comcom1311920180
arackirada.comcom100020180
antalyaline.comcom1102520170
altantekin.comcom100520180
akramermer.comcom1001120130
paykasatinal.comcom1242920180
fatihrent.comcom942020180
onetarz.comcom70020170
turexnakliyat.comcom130020180
121bpm.comcom60020180
hijyenegitim.comcom120420170
getzmakina.comcom101223220140
zeynepbutik.comcom110020180
finduksepeti.comcom120020180
bernetpay.comcom901920130
yasamkocumbenim.comcom150020180
ucgunlukdunyaedebiyati.comcom2202120120
paraistiyorum.comcom130420180
granitsilim.comcom110520140
ikincimedikal.comcom130120170
sesli-kal.comcom931620180
tuzlametal.comcom1001020180
noktapark.comcom90620180
cicekbahari.comcom112420140
seslimeleq.comcom100020180
temaled.comcom70020180
otomatikkapiturkiye.comcom1907120180
peryontv.comcom891020120
antalyaairporttransfertaxi.comcom260220170
teknebakim.comcom1001020180
newsfeedhub.comcom1101120180
klorcu.comcom60120180
kumsalrental.comcom120020180
binasiteyonetimi.netnet1642420170
razorbilisim.comcom120220180
erzincangazetecilercemiyeti.comcom2723720130
futuristagency.comcom140320180
canerkazar.comcom1005420180
gokcemmobilya.comcom1322420120
lukmedical.comcom100120180
bodrumkariyer.comcom130920180
mustafasevindik.comcom15131520180
ugurdemirtas.comcom1202720180
antalyaturk.comcom110220180
adilezzet.comcom9111020140
isyerikur.comcom901020180
onaymedikal.comcom1104820180
marjinaldergi.comcom130220180
parkpunkt.comcom90320180
kiremsantiye.comcom120520110
mefbilisim.comcom104520180
seecomments.comcom111020180
ucgunlukdunya.comcom130020120
kanarama.comcom801020180
yenikultur.comcom100220180
kocaelises.comcom100520180
tekatis.comcom72120180
ardreklam.comcom9335020180
barisbirtanir.netnet130020180
hisarkale.comcom901120160
micropazar.comcom1013120180
furkanahsap.comcom11121320180
mhmtdgn.comcom701120180
atesbocegiturizm.comcom16152820170
asmslc.comcom634219970
underlinewords.comcom14565820060
reclamart.comcom901120180
nizamet.comcom701120180
metroevdeneve.comcom1322220180
mavimerdiven.comcom1201220180
tabelareklammerkezi.comcom19112120180
aktuelcafe.comcom1001120180
kgajans.comcom723620180
sevgisaati.comcom1035020180
cesme2000.comcom952020180
manavgatisdunyasi.comcom1722320180
polatsezer.comcom100720180
akyapimarket.comcom123420180
mumcumakina.comcom110520180
singerdikismakinesi.comcom19187520080
cediyez.comcom792820140
agismak.comcom712110820020
bulentustun.comcom1102620071
rapalamarket.comcom1251520170
uakml.comcom513320180
evden.netnet513120166
sadecesahibinden.netnet160020121
tolsermedya.comcom1101920180
koltuk-temizleme.comcom160420180
yalitimmalzemeleri.orgorg1801520151
gebzeotokiralama.netnet1671120161
resimatolye.comcom110320180
bizimmanti.comcom100620180
kiddymobil.comcom1011120170
catiizolasyonu.orgorg140920152
ozenisinsaat.comcom1285620120
kgminsaat.comcom937866520110
yuzestetigi.comcom110220073
ceyir.comcom50220160
metanser.comcom843820030
larahamam.comcom90520180
lidyametal.comcom1011520130
astrolojitv.comcom1104120130
tofimar.comcom702620140
metsem.comcom61020170
rplayturkey.netnet111474820130
fsmotomasyon.comcom1201620180
catiyalitimi.orgorg120420152
ocdestek.comcom8595220170
fifthavegalata.comcom140020180
mersinmuzik.comcom1101220160
makeinturkey.orgorg120020151
dentropol.comcom921120120
gumrukhani.comcom100320120
keriminvestment.comcom15181220130
konyasahabeton.comcom1412420140
matrixtr.comcom80820140
mekansite.comcom90020180
atahansen.comcom90020160
ckcelektronik.comcom132720160
4selectronic.comcom121320170
4selectroric.comcom121020170
akraetiket.comcom101220170
bodrumtozboya.comcom131020170
dgksguvenlik.comcom120020170
dmr-data.comcom81820170
dreamaboutx.comcom1112920170
fspromosyon.comcom111020170
maketyem.comcom81020170
ozforje.comcom71120170
saraycikasm.comcom1121720170
elveayaksagligi.netnet151020171
kirmizikapi.netnet111220172
egeleneksel.orgorg110020170
kfoder.orgorg611620172
ankaratorna.netnet11101720181
ahmetkorhaneser.comcom150020180
atomixorganicbar.comcom160020180
balsapeyzaj.comcom110020180
beylikduzupaintball.comcom190020180
catalcapaintball.comcom160020180
centralfitlife.comcom140020180
durmusotomotiv.comcom140920181
ermakdemoincele.comcom150120180
herbalifeaktif.comcom140220180
kayseriimaraffi.comcom153620180
kocakir.comcom701820180
kvkkburosu.comcom100020180
lapisgarage.comcom110020180
mucizedavetiye.comcom140020180
mucizedavetiyeler.comcom170020180
mumuturkiye.comcom110020180
sehirmadencilik.comcom150020180
sistemplan.comcom100020181
starfidan.comcom90620180
streetfoodsfestival.comcom190020180
uyumburosu.comcom100020180
yavuzrustik.comcom110020180
yegentransfer.comcom130020180
izmirobezitemerkezi.netnet190020181
serimuhendislik.netnet150020181
ilmektekstil.comcom1231520081
mavikoseerkekyurdu.comcom180220180
hasanhusnualmas.comcom151020170
pensione.orgorg8321201816
miniplan.orgorg800200815
clearlens.netnet917935201814
medicalmart.orgorg11124200714
degirmen.orgorg8011201111
socialstep.netnet10214201710
korvet.netnet6821420129
galagali.orgorg801520128
servistar.orgorg90420188
brestrogen.orgorg10211920187
atlanticmotel.orgorg1301420077
kinderlink.netnet1001420186
copperfire.orgorg1001720126
dokustream.netnet103097520146
adamwilliamson.orgorg140720165
yarnball.orgorg80520185
beylik.orgorg661810020145
kehribartesbih.orgorg1411220185
dubaisafari.orgorg111385320185
elevatore.orgorg911220175
portallegal.netnet1102120095
startexport.orgorg110020184
agricorder.netnet100020184
alacatitransfer.netnet15374820124
lokalpolitik.comcom1201120094
michaelfink.orgorg110620144
saricakaya.comcom1001620184
saphane.comcom70220183
shimamaki.netnet92820143
spiritfilm.comcom1001120093
kofcaz.comcom60720183
hinohara.netnet802120173
formerin.comcom80020183
testvirus.comcom9221020023
toyotakarawang.netnet1403320153
edengolf.comcom802020103
globalenerji.orgorg1225120153
guneyorman.netnet100020182
naturalkehribar.comcom150020182
parajiujitsu.orgorg120020182
malthaven.comcom90020182
bankglobal.orgorg100020182
tamasoku.netnet80020182
celalcelik.netnet1001720132
salident.comcom80120142
marcoparma.netnet101320172
ucuzkozmetik.orgorg120320182
genisquare.netnet100020162
genisquare.comcom100020162
asirplast.orgorg90320162
tanimakmur.orgorg100620162
simoyama.comcom857020182
pehlivankoy.comcom110720182
harrystokes.comcom1111420172
attinghamtrust.comcom1401120072
apakambalaj.comcom11210320182
shorelinefire.orgorg130020062
medicifirma.orgorg111720172
balkanadolu.orgorg110020092
maltkingdom.comcom110020182
gamingposter.comcom120220182
salonsantana.comcom126920182
tarifpartner.comcom1201120162
villasanmarino.comcom1411920172
jademark.netnet801320182
opuslondon.comcom1092920182
mertgayrimenkul.comcom1501520122
monitorchina.comcom1201120102
pokersecurity.orgorg1301720082
aspenice.netnet8191620082
erciyesgrup.comcom1103520062
marksalzburg.comcom121548920142
puromichoacan.orgorg130020181
spiritmask.orgorg100020181
solotaxco.netnet90020181
guneymermer.netnet110020181
takaiminekarate.netnet150020181
simahali.netnet80020181
bayankuwait.netnet110020181
astarwood.comcom90020181
konaktemizlik.netnet13291520141
albanyalfaromeo.netnet150020151
ailegelisim.netnet110020151
yeniadana.comcom905720051
avalfilm.comcom81020171
berkshirepoker.orgorg141120171
turboslip.comcom91120171
virangana.orgorg90020181
ankarafilm.netnet100020181
brunnenkamp.netnet110020161
brunnenkamp.comcom110020161
trapgaming.comcom108820161
kenyanigeria.comcom120020161
masalotel.comcom90220131
kraldavetiye.comcom1201020121
irisnailsalon.comcom130120161
genelpamuk.comcom1001520181
faunatrap.comcom90220181
drainsure.comcom91220171
deregering.comcom1001220091
demirtarim.comcom100220181
dellesite.comcom90720121
bilgedekor.comcom1001120181
bestpricehost.comcom1305720081
bayramkaratas.comcom1301220071
gabiebru.comcom80020181
afyonbranda.comcom110220171
daryasanat.comcom10203920171
generising.orgorg102620111
nobleshirt.comcom100020181
aryadanismanlik.netnet150320181
yellowfont.comcom101472020131
forkayla.comcom812420041
ucuzkereste.comcom1101420181
transitafrica.orgorg130020181
somastrong.comcom1011920131
nameforest.netnet101920181
georgefilm.comcom1096720031
ageofink.comcom853220111
antikcentrum.comcom12286920171
almacenesara.comcom120520181
timbergrip.comcom100220181
trapradar.comcom901020141
gaziahsap.comcom901220151
marcobani.comcom922220181
moonposter.comcom1003520121
yasintemel.comcom1001620181
centertank.comcom1001020151
brusmart.comcom80720121
arackira.comcom805520181
storeker.comcom80220181
mizahi.netnet602720181
lakethompson.netnet120020181
elektroniktest.comcom1421420111
markange.comcom80220181
postporto.comcom90820101
sessizfirtina.netnet131020171
cayirovaspor.netnet120820081
pizzanantes.comcom110120111
vizeingiltere.netnet1304120081
faithmarket.netnet1194620181
makisato.comcom802320121
tuzlagrup.comcom91034220181
volifortaleza.comcom1327020091
studiomaket.comcom1102220181
velibababaharat.comcom1564220171
incestart.comcom9850620151
mayawood.comcom8477820181
galaxster.comcom9412720051
hucresave.comcom90020190
igdirkusu.comcom90020190
camposglobal.comcom120020180
maltsidney.comcom100020180
sefertime.comcom90020180
petitefestival.comcom140020180
lindasgram.comcom100020180
faroholding.comcom110020180
badeharar.comcom90020180
starforrest.comcom110020180
globalsanluis.comcom130020180
benifitci.comcom90020180
thaibinhvietnam.comcom150020180
dadaytame.comcom90020180
beherefor.orgorg98020180
yogasuriname.comcom120020180
vatanstudio.comcom110020180
surinameyoga.comcom120020180
sanosist.orgorg80020180
modatono.orgorg80020180
mirapaca.orgorg80020180
makojiujitsu.orgorg120020180
bankerbelt.orgorg100020180
solozihuatanejo.netnet150020180
solocuernavaca.netnet140020180
balkanstory.netnet110220180
stilografik.comcom110020180
servisulasim.comcom1226020180
hostleisure.comcom110020180
danatolosa.comcom101020180
aminsistem.comcom100020180
portosegurocoin.netnet150020180
yogabhubaneswar.comcom150020180
yildirimbutik.comcom130020180
yerelsozcu.comcom100020180
victorytango.comcom120020180
troutlakeestate.comcom150020180
stationeerie.comcom120020180
starkanpur.comcom100020180
serapsimsek.comcom110020180
rosamodabolivia.comcom150020180
portosegurocoin.comcom150020180
pilavaskibursa.comcom140020180
panhandlehail.comcom130020180
omegaabrasive.comcom130020180
mostroman.comcom90020180
morantalk.comcom90120180
mercantika.comcom100020180
liberalputnam.comcom130020180
lanethudson.comcom110020180
komaidam.comcom80020180
kanabdeli.comcom90020180
holdingnine.comcom110420180
hizlifutbol.comcom110020180
futbolayakkabi.comcom140020180
flyingtender.comcom120020180
durumira.comcom80020180
contadorachile.comcom140020180
butternutmail.comcom130020180
begumsabina.comcom110220180
bayrambebe.comcom100020180
basicamino.comcom100020180
barkbarkboulder.comcom150020180
barbaranot.comcom100020180
babapeerjada.comcom120020180
ahsapsedef.comcom100020180
coinvals.comcom80020180
pointestetika.comcom130120180
minaoncel.comcom90020180
menasaat.comcom80020180
komahana.comcom81020180
kaftanburada.comcom120020180
galerimandar.comcom1239657120180
castelarsuit.comcom120020180
bayraktarmenkul.comcom150020180
ambalajiste.comcom110020180
pasakbali.comcom90020180
tanisgrup.comcom902420180
turbantees.comcom100220180
yurttrafik.comcom1001020180
yetistep.comcom804120130
valeriedecorby.comcom140120180
uygunsapka.comcom1001520180
talkocala.comcom90120130
spanishpilot.comcom120220140
sedacevizli.comcom110020150
riflebandoleer.comcom140020120
adamedwardyoga.comcom140320180
primsorgulama.comcom1303520130
avazcoin.comcom81620170
hongfabl.comcom81020170
filoturktrakya.comcom14121520170
evicmaritime.comcom121020170
atabeykasikci.comcom131320170
hartwonder.comcom101020170
perlpilot.orgorg91020170
turkcecoin.comcom101220170
trensinaloa.comcom110120170
topraknakis.comcom111220170
sevincaydin.comcom111320170
modelparke.comcom101020170
lureform.comcom80420170
kefirstarters.comcom131120170
kanyonlimonlu.comcom131120170
joesdealspot.comcom121420170
fidecolombia.comcom121220170
develoire.comcom91220170
damlakibar.comcom101120170
dahafazlaadalet.comcom151120170
chebbinagaraj.comcom131420170
baakburada.comcom100320170
airwayplan.comcom101220170
adaletlazim.comcom111220170
sinopkumsal.comcom111120170
elcaminogestalt.comcom150620170
talcabina.comcom91220170
seyhansite.comcom10108291020180
fotopacific.comcom110620180
starmediaagency.comcom150220180
centurylens.comcom110120180
fethiyemotel.comcom12328520180
talksummer.comcom100120180
pirepoint.comcom90120180
taraftargazete.comcom143544220180
kartalevi.comcom90120180
kingeden.comcom80020180
warwickpotter.comcom130720120
meralana.comcom80020180
zaferdekor.comcom1001020180
erzincanmagazin.comcom1501020180
golfmagli.comcom90020180
serenastar.comcom100920170
mahyafile.comcom902020180
milasangels.orgorg118720180
ambalajyurdu.comcom120020180
nikahstory.comcom100120180
sanslikoltuk.comcom120220180
onurereninsaat.comcom140020180
ambersoho.comcom92020160
jaipurleheriya.netnet140020160
jaipurleheriya.comcom140220160
resultura.netnet90020160
pasteldubai.comcom111920160
balimerci.comcom911620160
problemnova.comcom110120160
janesvilledeli.comcom140220160
finalpatron.comcom110120160
dollarpens.comcom100420160
nigeriakenya.comcom120020160
nairobilagos.comcom120020160
lagosnairobi.comcom120020160
sitemider.comcom94020180
tankermanagers.comcom140320180
moritukuritai.comcom132120160
isciicin.comcom80420180
parsiskala.comcom100720180
parkridgesalon.comcom140220150
panamadeepwater.comcom15102120180
tersturnike.comcom11133220180
medicalintan.comcom1266920180
odemisgundem.comcom1202220180
nilessalon.comcom100520150
murekkepplaza.comcom130220140
lindaguatemala.comcom1441720180
kinikgundem.comcom110020180
kaseperu.comcom80220150
karasuguvenlik.comcom140220150
sivilakil.comcom91120170
juniperfestival.comcom150220140
kalttire.comcom80020180
indinatural.comcom110120140
hunterpass.comcom1001420180
hayatoptik.comcom1002220180
hartfiji.comcom841620110
reelsturgeon.comcom120120180
karekase.comcom825520170
gramturkey.comcom10524120180
futbolheritage.comcom1402620100
spelledink.comcom100820180
bombostore.comcom100120180
fikirkalem.comcom100220180
ferrisfoto.comcom1011320170
fatihapak.comcom90620180
esentrafik.comcom1001220180
revizyonbilisim.comcom151220170
enikenergy.comcom100120120
efsanebufe.comcom1001220180
dorukliman.comcom1001520180
dongguangolf.comcom120220180
donerhane.comcom90320180
desteksifa.comcom1001220180
analizsikayet.comcom1354220170
cilekkonya.comcom100320180
castlefireball.comcom1401920010
canlitest.comcom90020110
canlideneme.comcom110220110
canlibeyaz.comcom100020120
butikyayin.comcom100020110
butikkocak.comcom100920180
balakgunung.comcom110420130
aylawray.comcom811220120
austinforklift.comcom1401420140
aromahunt.comcom90120140
anonsajans.comcom1001520180
amberorvin.comcom100120160
amantika.comcom80220130
altouruguay.comcom110320180
aleminsaat.comcom1001520180
akilliyayin.comcom110020110
akillideneme.comcom120120110
ahenktanitim.comcom1211220160
ahenkajans.comcom1001820160
afyonlazer.comcom100620170
aceledevren.comcom110220120
snowmassfire.orgorg1201020120
saltaalto.orgorg901720150
lakesunapeehome.orgorg150320140
bergertest.orgorg100020140
ivenkile.comcom80120180
liftcranevideo.comcom14341820150
beautyasritual.comcom1423020170
sofialva.comcom82420130
parksorrento.comcom121720170
oregonstart.orgorg111252520140
titanthailand.comcom130720160
azimenterprise.comcom141520170
phillipshost.comcom1202320120
rainbowpastel.comcom1362420180
markhunters.comcom1101120180
mobilyarestore.comcom14113120180
lenabutik.comcom9502420180
belmatis.comcom80620180
casslakemarina.comcom1494120170
suretrail.comcom901120160
southshorepark.comcom143120180
sihirliminber.comcom1301120120
isikcingil.comcom100420180
koftecisavas.comcom1231320180
firethornmedia.comcom1401320150
starsaviour.comcom110020130
otisbank.comcom81220170
maestrokompas.orgorg13151920120
vedaghana.comcom912920180
hammerbin.comcom901920180
readinglake.comcom110520180
katanahome.comcom1001120140
bombadulce.comcom1002120140
affipark.comcom80020180
summerfieldsuit.comcom1501020180
ilkegrup.comcom801820180
sivasvoleybol.comcom131274020170
serviandamios.comcom1301320180
hazardmonitor.comcom1302020180
elifpecete.comcom1002720180
golfkunming.comcom111420170
hakikilezzet.comcom120220150
sezonayakkabi.comcom1302120180
modatuba.comcom8116220130
bolukiralikarac.comcom1502320120
lazerkart.comcom90420180
markbaskin.comcom1001020130
tylernoel.comcom901220130
almamorena.comcom1001620150
kizilcamedia.comcom123372620180
centertaksi.comcom1101320140
cabanagold.comcom100220160
zonktime.comcom80620150
gundemusak.comcom1045120180
formpure.comcom81820170
guneykasabasi.comcom130620150
oceanviewvideo.comcom140520180
fosterposter.comcom120620150
platetogo.comcom90720180
lovingfoto.comcom100720180
muglayazilim.comcom120620180
yamahaleases.comcom123620180
americaprinter.comcom1417820170
sivaskariyer.comcom1202220180
yalovakamera.comcom12523620180
mealpigeon.comcom100720180
ogretmenara.comcom1101820120
hopefile.comcom80520180
verimlituketim.comcom1472520180
umutguven.comcom90820180
ihsankaya.comcom902320130
inditalent.comcom10737320180
kilebaker.comcom903320180
ortakmarket.comcom111820170
sonsuzumut.comcom1002620180
emirreklamcilik.comcom1501720180
kuryeizmir.comcom1062520180
amitmania.comcom90220180
locaturk.comcom801220180
morgates.comcom804720030
zonaroma.comcom81420170
sadecebursa.comcom1113320170
parfumsatis.comcom110620180
bezirganbasi.comcom120620160
firesideforum.comcom130820160
lamabrand.comcom91820160
canadalogos.comcom1102220150
sarftoptan.comcom100020160
zunimail.comcom80820130
malaysiarant.comcom1203220180
bellcanadasite.comcom1464620180
artistann.comcom9373920180
fotogokce.comcom926920180
hangiusta.comcom901420100
kentsummerball.comcom14142720170
dokuipek.comcom8594720180
minezeybek.comcom100020120
iznikpazar.comcom1031920180
neontexas.comcom902220110
panosazan.comcom9158120180
aromabangkok.comcom122006911020150
akillitest.comcom100020110
isvicreegitim.comcom1323220170
metahatch.comcom90020180
floridalma.orgorg1010822320180
alanestates.netnet110820080
karadenizradyo.comcom1402120140
eczareyon.comcom915220180
grantaday.comcom903420180
akillidershane.comcom1401620110
sahinoptik.comcom1001820180
onurezgi.comcom801120180
pantelleriafoto.comcom1503620180
markatwood.comcom1042220170
melekcicek.comcom1002620180
celeptriko.comcom1011320180
zenginneon.comcom1021420180
fenerlitarim.comcom1222720090
hakankurum.comcom100220180
grupdilek.comcom901720180
turacyapi.comcom901120180
antikagac.comcom9421520180
sevgiperde.comcom1001120180
pakistanglobe.comcom1305419990
projetarim.comcom1001620180
bariscanta.comcom100020180
atiskuafor.comcom1002620180
yenidoga.comcom802020180
atakrulman.comcom1051520180
renklipudra.comcom11345120170
lamarissa.comcom9781520170
simalixia.comcom91410620090
sedeftarim.comcom1001020180
akasyahome.comcom1021720180
muglakampus.comcom1102220180
laketrafford.comcom1218912120160
kentfenwick.comcom1111820170
yeniyagmur.comcom1001120180
starfart.comcom801220180
soloaxis.comcom811720170
uygunmermer.comcom11111820170
tarpmotor.comcom912320060
manisaradyo.comcom110920180
yesilkopek.comcom10583420170
erdemliteknik.comcom13188920060
yigitolur.comcom925020120
dogalortam.comcom1001520180
rumbabuena.comcom10153020180
hillvideo.comcom902520020
pozitifdizayn.comcom13014820180
pokerforumsite.comcom141329920180
yasinyanik.comcom100120180
springspolice.comcom13527620010
ozguraltay.comcom102019120060
metalimalat.comcom113113220180
karyamobilya.comcom122819420020
balearesliberal.comcom155487320130

Dün ve daha önceki günlerde düşen alan adlarını linkte bulabilirsiniz: Dün Düşen Domainler




Uzantı alan adlarını uzantı türüne göre bu bölümde görebilir ve tablo sıralamasını bu sütündan değiştirebilirsiniz. Eğer sadece COM uzantılı adresler ile ilgileniyorsanız aşağıdaki tabloda “Bul” kısmına “.COM” yazmanız halinde sadece bu uzantıya sahip adresleri görebilirsiniz. Sitemizde sadece önde gelen 3 uzantıya yer veriyoruz. Bu kısımda .NET ve .ORG uzantılarını da aynı yöntem ile listeleyebilirsiniz.

Uzunluk bu sütunda alan adlarını karakter sayısına göre küçükten büyüğe yada büyükten küçüğe doğru sıralandırabilirsiniz.

Backlink sayısı alan adının sahip olduğu toplam backlink sayısıdır. Maalesef internette düzgün çalışan API bulmak çok zor olduğu için bu verilerimiz güvenilir değildir. Eğer backlink değeri için alan adı alacaksanız lütfen kendiniz de adresi sorgulayınız. Tablomuzdaki veriler yüzde yüz doğru değildir bu sütunumuzda.

Archive sütununda adresin archive.org sitesinde yer alan kayıt sayısını görebilirsiniz. Domainin daha önce hangi kategorilerde ve aktif olarak yayın yapıp yapmadığına dair bu bölüm fikir vermektedir.

Son Kayıt sütununda adresin bilinen en eski kayıt tarihi yer almaktadır. Domainin geçmişi için önemli bir kriterdir.

Toplam Kayıt sütununda ise com, net, org gibi kaç farklı uzantısının kayıtlı olduğunu görebilirsiniz.


Satılık Alan Adları

Haftanı popüler webmaster forumları ve domain platformlarında devam eden açık arttırmaları ve hemen al fiyatlı satışlarını aşağıdaki listemizde bulabilirsiniz.

Listemiz sürekli güncellenecektir, alan adları ile ilgileniyorsanız lütfen yazımızı hafta boyunca takip edin !

Açık arttırmada olan alan adlarının isimlerine tıklayarak satışın yapıldığı sayfaya gidebilirsiniz.

İlgilendiğiniz Adresler İçin Linteki Bağlantıdan Bize Ulaşabilirsiniz: Domain Satış

DomainKategoriFirmaKayıtBitiş
hiyeroglif.comJenerikNameBright20162020
kofa.netCVCVGodaddy19982020
sosyaluzman.comWebmasterNamebright20182020
sosyalasistan.comWebmasterIonos20192020
iletisim.orgGenelGodaddy20012020
kocaelihaber.orgHaberGodaddy20072020
etkinhaber.comHaberNamebright20072020
ressam.netGenelGodaddy20022020
beyler.netGenelGodaddy20002020
firmalar.orgE-TicaretGodaddy20062020
mp3indir.orgGenelGodaddy20032020
guzelseo.comWebmasterGodaddy20192020
ucretsiztema.comWebmasterNamebright20192020
seoscore.netWebmasterGodaddy20172020
adanaliyik.comGenelNamebright20152020
muhi.netCVCVHostingcomtr20192020
pezu.netCVCVNamesilo20192020
vohe.netCVCVHostingcomtr20192020
levu.netCVCVHostingcomtr20192020
kevu.netCVCVHostingcomtr20192020
luhi.netCVCVHostingcomtr20192020
gihu.netCVCVGodaddy20192021
pevu.netCVCVHostingcomtr20192020
gundem724.comHaberGodaddy20192020
mangir.netCoinHostgator20172019
zerzevat.netGenelGodaddy20112019
gorselarama.comGenelGodaddy20182019
gorselbilgi.comGenelGodaddy20192020
aranmahacmi.comWebmasterGodaddy20192020
ozgunyazi.comGenelGodaddy20192020
bagcilar.coİlçeGodaddy20192020
gaziosmanpasa.coİlçeGodaddy20192020
sariyer.coİlçeGodaddy20192020
kagithane.coİlçeGodaddy20192020
catalca.coİlçeGodaddy20192020
buyukcekmece.coİlçeGodaddy20192020
gungoren.coİlçeGodaddy20192020