07 Temmuz 2019 Pazar düşen domain (alan adı) listelerini yazımızın devamında bulabilirsiniz.

Domainlerin düşeceği gün, en geç saat 17.00-18.00 saat aralığında günün listesi sitemize eklenmektedir.

Facebook’ta Takip Et, Listeler Eklendikçe Haberin Olsun: https://www.facebook.com/isimyakala/


Domainler Ne Zaman Saat Kaçta Düşecekler?

Alan adıları yıllık olarak satın alınmaktadır ve eski sahipleri tarafından yenilenmediklerinde boşa düşerek tekrar satın alınabilir hale gelirler.

Farklı uzantılara sahip alan adlarının bugün akşam hangi saat araşığında düşeceğini linkteki yazımızda görebilirsiniz. En çok takip edilen .COM ve .NET uzantılar akşamları saat 20.30’dan sonra düşmeye başlamaktadır. Aşağıdaki listelerdeki alan adları bugün akşam düşecektir henüz düşmemiştir ! Detaylı bilgi için: Domainler Ne Zaman Boşa Düşer

07 Temmuz Bugün Düşecek Alan Adları

Aşağıda kategorilere göre ayrılmış alan adlarının bir kısmını görebilirsiniz. Bugün sizler için seçtiğimiz alan adının tam listesini yazımızın alt bölümlerindeki tablomuzda görebilirsiniz.

Jenerik domain önerileri;

Jenerik alan adları bölümünde TDK Sözlük anlamlı düşecek alan adları listelenmektedir.

akaret.info
anik.info
aritma.info
atamak.info
evrim.org
fanya.org
fellah.org
fennimuayene.org
fikih.org
gerontoloji.com
gumruk.tv
gumuscu.org
husun.org
iskarta.com
izci.tv
kadinhareketi.com
komurluk.net
kuyum.tv
manivela.net
multimedya.org
onurlu.net
ortodonti.info
petrolcu.com
sabanozu.com
sabanozu.net
sabanozu.org
seferi.org
uyusma.com
varan.net
yorukcadiri.net

07 Temmuz Düşecek Domainler Listesi

Aşağıdaki listedeki bul kısmına bilgi, sağlık, araba, haber, tekno, ekonomi, kadin, indir, tatil, emlak, bilet, kripto, sohbet, yemek, bebek, kitap, hediye, moda, oyun, sigorta, kredi, indir gibi kelimeleri yazarak sadece o kelimenin geçtiği alan adlarını görebilirsiniz.




DomainUzantıUzunlukBacklinkArchiveToplam Kayıt
eurosohbet.comcom104570
vizebilgisi.comcom112586280
ozkaradenizemlak.comcom161990
erzincansohbet.comcom141210
ucakbiletinet.comcom13151800
elektrikkitaplari.comcom172150
arabamuayenesi.comcom140200
hemmenindir.comcom110111
sohbetv.comcom721580
sohbetlere.comcom10131251
kitaphome.comcom90220
haberinzamani.comcom1313511
onderemlakinsaat.comcom161110
imajsohbet.comcom10282640
bayindir-pvc.comcom1228390
kupayemek.comcom91120
emlakyazilimi.netnet131101
direkindir.netnet100112
teknolojiuzmani.netnet152171
sohbetviva.netnet10081
sarihaber.comcom96380
kayseriemlakci.comcom14030
hayatbilgilerim.comcom150130
yapikredibank.comcom131602
oyunteknoloji.comcom1310300
aysebebek.comcom9010
askeroglusigorta.comcom16010
sedefbilgisayar.comcom150150
karasukuzeybilgisayar.comcom212240
guzmanlastra.comcom122631200
doraoyunlari.netnet12431744
bidolubilgi.comcom1168971
kitapariyorum.comcom130140
ekonomikkitap.comcom130160
platform-haber.comcom141190
haoyuntz.comcom8000
notebookbilgisayarservisi.comcom251340
datcabilgisayar.comcom150241
charterucakbiletleri.comcom20060
haberbg.comcom7011
onlinebilethatti.comcom160121
emlakmetro.comcom100180
sabahtanalhaberi.comcom1637301020
telefonmagazasi.comcom150160
oyunbavulu.comcom108470
teknolojibulten.comcom155430
indirmobi.comcom90350
haoyunli.comcom8070
portemlak.comcom9050
pratikbilgisayar.comcom16641460
sohbetodalari18.comcom15394392
dmremlak.comcom80151
hasanagaisikemlak.comcom17010
info-teknologi.netnet1476122
enuygunbilgisayar.comcom172210
ensonteknoloji.orgorg149281
enucuzucakbilet.netnet15004
eylulemlak.netnet107502
teknotelguvenlik.comcom16010
sigortalievdenevenakliye.comcom2451450
sigortanedir.comcom1211350
osgbhaberleri.comcom13000
surucusuzaraba.comcom14020
melihbircansigorta.comcom18070
fokusemlak.comcom10000
habertarafsiz.comcom13071
kocaelidenemlak.comcom15000
didimogretmenemlak.comcom182007370
gocmenemlak.netnet11000
yilmazemlakdanismanlik.comcom22050
biletari.comcom8060
teknolojiakademisi.comcom1816430
psbilgisayar.comcom122270
indiriminadresi.comcom15040
a101indirim.comcom118780
kmemlak.comcom7000
akademiteknologiasia.comcom200100
alisonhaberlcsw.comcom151110
antalyahavalimaniarabakiralama.comcom30340
bilidteknoloji.comcom141290
emlakbayrami.comcom12080
emlakbizdenalinir.comcom170140
emlakmanya.comcom100160
emlaksenligi.comcom12010
haber-metre.comcom11010
ilangluzman.comcom110110
iqoyunlari.comcom10000
kataloghaberleri.comcom160120
haberlandheadshots.comcom180140
ninubebek.comcom9000
duzcebiremlak.netnet13001
karabas-shop.comcom12160
sakaryaemlakhaberleri.comcom212280
vansigortam.comcom111240
asigortazeytinburnu.comcom1968190
nexusbilgisayar.comcom15020
varliksigorta.comcom131300
kanyonbilgisayar.comcom16070
isteyemek.netnet9001
yemekariyorum.comcom13070
maibaoyundian.netnet13017
architectluilliguzman.comcom21010
indiroar.comcom8000
oguzemlakgyd.comcom12020
onemoorehabersetzer.comcom19010
wilindirdark.comcom12110
bilginow.comcom8710
elemegihediyem.comcom14010
kuponileindirim.comcom15010
mhdindir.comcom8020
saiisatekno.comcom11000
emlakavrasya.comcom12020
rabiaemlak.comcom100130
sanliurfakirvememlak.comcom20030
beyazcatiemlak.netnet14001
aocemlak.comcom8010
cepmuzikindirx.comcom14114441
haziryemeksepeti.comcom16010
tayyaremlak.comcom11010
teknomarker.comcom111110
meijiaoyun.comcom10001
teknoeduca.comcom10030
acilhaber.netnet9072
sarikamishaber.comcom140180
teknoblinds.comcom11011
ucakbileticharter.comcom17010
yemekoneri.comcom100100
sabahtanalhaberi.netnet16010
agluzman.comcom8000
woyunker.comcom8010
beydagliemlak.comcom13000
esemlaktorbali.comcom14000
keraemlak.comcom9000
merkezemlakmardin.comcom17000
mertemlakinsaatseferihisar.comcom26000
yavuzemlakmalkara.comcom17000
ayanisemlak.netnet11000
anadoludanhabere.comcom167100
ankarabalgatnalkiyat.comcom20000
besiktashaberci.comcom15000
butatilbutatil.comcom14060
butatilkampanya.comcom15010
hataytekhaber.comcom13000
heraytatil.comcom10000
karamanlilaremlak.comcom17000
kitaplargezegeni.comcom16000
kredikartiylaonlinehgsyukle.comcom27000
kripton7.comcom8000
noktaemlakbursa.comcom15000
oyunejderim.comcom11090
spsbarabanki.comcom12000
umraniyehaberi.comcom144100
uzmanoneriyor.comcom130120
ramazansohbetleri.netnet17000
bonus-tr-mobil-hediye.comcom21000
bonus-tr-mobilhediye.comcom20000
danawateknologi.comcom15020
ekonomik-teb.comcom12000
ekonomikgundem-teb.comcom18000
esubeyapikredimobil.comcom19000
jahetekno.comcom9000
maximum-tr-hediye.comcom17000
maximum-tr-hediyeler.comcom20000
biletcioglu.comcom11000
bimeksteknoloji.comcom15000
dijitaloyunhukuku.comcom17000
emlakobjektif.comcom13000
ensaglamhaber.comcom13050
kitapyurdunuz.comcom13000
kriptolarim.comcom11000
sigortabuu.comcom10000
sigortabuu.netnet10000
feisuoyun.comcom9000
baoyunmall.comcom10000
uzmanuroloji.comcom12000
ccebongbebek.comcom12000
elektronikteknolojisarayi.comcom25000
elektronikteknolojibayi.comcom23000
teknoscholl.comcom110110
magazaradyotv.comcom13000
marmaratek.comcom100741
seslicity.comcom9681380
seferoglutarimurunleri.comcom223100
mustafaozogul.comcom13000
bizimkampanya.comcom13000
hazarinsaat.comcom110162
eroskozmetik.comcom122161
adaytanitimi.comcom123180
babilisim.comcom966400
evealisveris.comcom12090
reklamofis.comcom1016280
1otel.comcom50151
sesliturkce.comcom110280
turturk.comcom70201
satisdestek.netnet110121
mehmetcakir.netnet110144
parasaymamakinesi.netnet17141032
ko-turk.netnet71112
madamo.netnet614416
aktifyapi.netnet920436204
osmangumus.netnet102161
chatkral.netnet8102192
biztelekom.netnet100100
karbilisim.comcom100101
aquakozmetik.comcom120120
sngayakkabi.comcom110420
kompresorculer.netnet140130
ozcelikbranda.netnet131682
beyoglusurucukursu.comcom18090
askkoyu.comcom71420
cevreedin.comcom94330
guneshaliyikama.netnet150213
sinavkayit.comcom100101
evliliksepeti.netnet130221
etiketdukkani.comcom13010
cingenepazari.comcom132150
bilisimkent.comcom11060
aktifkombi.netnet10071
ciceksepetionline.comcom17000
muratkilinc.netnet110344
spotpvc.comcom70140
dukkaniletisim.comcom14000
karlial.comcom70120
azimstore.comcom90170
72batman.comcom80320
rutravelling.comcom12000
basaksehirmobilya.comcom170130
konutvideo.comcom10843140
uludagfirsatlari.comcom16000
eneger.comcom626723521
izmirmilletvekiliadaylari.comcom25000
benimadayim.netnet110114
palandokenbilisim.comcom17060
kucukcekmecearcelikservisi.netnet2635293
hendek54.comcom80100
dizagrisi.netnet97351
teknikisanahtar.comcom1510311
transfertoairports.comcom180430
adanabarkod.comcom110101
meyvecim.netnet8061
samsunseyahat.comcom13060
buyinistanbul.comcom13160
demirermakina.comcom13050
bahcesehirtemizlik.comcom185560
sigortimes.comcom100100
bsgrupsakarya.comcom130200
almacasatmaca.comcom13070
kartturkiye.comcom1113460
cicekcikonya.comcom120170
kadifedenkesesi.comcom15040
sehirvebolgeplanlama.comcom201040
zirvehafriyat.comcom132470
yapitrend.netnet96972
hendekli.comcom84340
sporpress.comcom91531
nakliyatevdenevenakliyat.netnet240501
yenerburak.comcom100240
aligultekininsaat.comcom170150
buyuculer.netnet90211
imexglobalgroup.comcom15000
deniz-han.comcom9020
tatgurme.comcom811880
genclerinmodasi.comcom1512490
kayakfirsatlari.comcom15000
sossale.comcom7061
modavemoda.netnet1020891
ustundagotolastik.comcom172190
magickidsbox.comcom12000
outletdukkani.comcom13011
standartlokma.comcom132110
a-nisa.netnet61150
morgulet.comcom81230
dunvebugun.comcom102200
sutamircisi.netnet11001
yenibosnadugunsalonu.comcom200260
osbmuhendislik.comcom143130
hellotoistanbul.comcom15010
byghome.comcom7000
medyumsikayetler.netnet160132
manivela.netnet82981512
tesetturgiyimkabini.comcom193461770
turkdoc.comcom70130
turkdoc.netnet7000
kasabarehberi.comcom13490
atalaroto.comcom9490
lazeranimasyon.comcom14011
farmasiyeuyeol.comcom14013
arftasimacilik.comcom14060
dogusanasansor.comcom14030
park232ayrancilar.comcom1711380
3dhalilar.comcom9000
ak-nmerkez.comcom10000
akkogrup.comcom8010
aksarayotoekspertiz.comcom19010
akyazimadencilik.comcom160130
atasehirofismobilya.comcom19010
ayakkabihome.comcom120110
bahcemobilyalaritamiri.comcom220220
balikesircomputest.comcom18010
bazaltplak.comcom10030
buyunasilbozulur.comcom160361
canlisecim.comcom100101
cavuskoylucam.comcom13071
demirhali.comcom9000
demkartus.comcom9000
drnambalaj.comcom10030
duskabinprofil.comcom14010
duzceotoekspertiz.comcom17020
e-isyerihekimi.comcom140160
elitkrom.comcom80292
emuzikmarket.comcom126150
erginhaliyikamamakinalari.comcom25050
erkanozhan.comcom100120
eselekliyapimarket.comcom18010
evrimeseryel.comcom120300
flyodeme.comcom8010
geliyorgidiyor.comcom140140
getirmebuyusu.comcom130250
granitplak.comcom10010
hastermal.comcom9080
hatayotoekspertiz.comcom17010
dengeisguvenligi.comcom164120
iskitlerotoekspertiz.comcom20010
karsotoekspertiz.comcom16020
kasabatv.comcom80120
keciorenotoekspertiz.comcom20770
kucukleralisverismerkezi.comcom24010
sossale.netnet7001
mardinotoekspertiz.comcom18110
midyatinsaat.comcom12000
midyatmakina.comcom12000
midyatturizm.comcom12000
midyatyapi.comcom10000
muhammedyucel.comcom13090
nariaajans.comcom10010
nsmgrup.comcom7010
oksijencanavari.comcom150220
otomatiktakip.comcom13000
ozlemkuzucevirme.comcom1642460
park232gaziemir.comcom15010
esyadepolamaa.comcom131340
360proje.comcom80130
724otocekici.comcom12011
a-nisa.comcom60580
adanarulo.comcom9030
arfservis.comcom9010
arftedarik.comcom10010
atomsutlac.comcom100210
autoparsotoekspertiz.comcom20010
avsarhavalandirma.comcom17030
balakaninsaat.comcom13010
bisifir.comcom7070
bodrumsedir.comcom119110
dgntente.comcom812120
enfaokullari.comcom120240
farmasiyekayit.comcom140142
furuzeotomotiv.comcom14010
grandhomemobilya.comcom162450
kaylaajans.comcom102310
lolvidyo.comcom84290
madamaydanoz.comcom12060
magnesiasoft.comcom12030
magnesiasoftware.comcom16020
magnesiayazilim.comcom15000
mbsgrup.comcom7080
otizmgaziantep.comcom14010
ozelegitimgaziantep.comcom19010
puffyhome.comcom9010
sarndesign.comcom10060
saudivintage.comcom120270
treedestek.comcom10010
tutakapart.comcom10260
ucuzotelleribul.comcom15010
kemalbalaban.netnet1273711
magnesiasoft.netnet12010
magnesiasoftware.netnet16020
magnesiayazilim.netnet15000
modalarda.netnet9001
saudivintage.netnet124600
sbkirtasiye.comcom11050
guneydogucambalkon.comcom18000
gunespanelcim.netnet13000
alpgida.netnet7012
emessaoffice.comcom12060
tmoft.comcom50310
cavuskoylucam.netnet13001
eroskozmetik.netnet12001
trendsilver.netnet11002
aksdergisi.comcom10000
samirajans.comcom10090
konyasanatmatbaa.comcom16020
petbeykoz.comcom9000
etkilimedyumlar.netnet15084
royalkaz.comcom8000
kartepefirsatlari.comcom17000
takasmatik.comcom100200
cadde75.comcom7110
turhalesnaflari.comcom152360
hendekli.netnet8000
megamermer.netnet10001
birfirma.netnet83351
alerjisizbirhayat.comcom17010
altinbasak-zenga.comcom16050
aocreklam.comcom9010
atilimzemin.comcom11020
aydonatteknik.comcom13070
basaksehiresnaflari.comcom19010
bedavainternetpaketimiz.comcom23030
bizimbakkaliye.comcom14010
bluomp.comcom6000
dlgciftciklubu.comcom14010
dlgciftcikulubu.comcom15010
dlgfarmerclub.comcom13010
e5plus.comcom6072
enkaremimarlik.comcom14020
ercansaygin.comcom11010
ersanmechanism.comcom14010
ersanmetalgoods.comcom15010
ersanmetall.comcom11010
ersanmetallgoods.comcom16010
ersanmetalproducts.comcom18010
fasonmedya.comcom10010
femme-donna.comcom11010
fikriasimistanbul.comcom17010
gaphayder.comcom9050
hanedanurunleri.comcom15010
haraccidugunsalonu.comcom180130
hellototurkey.comcom13010
imkaotomotiv.comcom12010
ist-arb.comcom7010
iznikyufka.comcom10010
kanvasbaskiantalya.comcom180140
kasedukkani55.comcom13010
kimlernerde.comcom11010
kiralikkbahissiteleri.comcom2140140
kiranotu.comcom8010
lineerdizayn.comcom12020
longhashtag.comcom11000
maydnoz.comcom7010
otoelektrikyolyardim.comcom20010
patakuta.comcom8020
rawyapim.comcom8190
sakalarserenity.comcom157380
specialdrage.comcom120170
taksisafe.comcom9010
ukcitydecor.comcom11000
ukcitylogistics.comcom15000
utt-technology.comcom14000
virawind.comcom8010
yenidalioptik.comcom131410
aktifkombiservisi.netnet17023
aocbilisim.netnet10001
bluomp.netnet6000
buyinistanbul.netnet13000
e5plus.netnet6002
etkilimedyum.netnet120163
falbakimi.netnet9262
gercekhoca.netnet10901
hellotoistanbul.netnet15000
hellototurkey.netnet13000
hippara.netnet7060
kartturkiye.netnet11000
medyumhocatavsiye.netnet17091
mtnguvenlik.netnet11001
photonturkiye.netnet13001
steroidsiparis.netnet140113
taksisafe.netnet9000
ramiotoekspertiz.comcom16010
restatetime.comcom11010
siyasitaraf.comcom11060
sultanbeyliotoekspertiz.comcom23011
taksitgiyim.comcom11010
tarsusotoekspertiz.comcom18011
turanpizza.comcom10010
umraniyeofismobilya.comcom19010
yazdigi.comcom7010
yelkencirestaurant.comcom180110
yildizep.comcom80110
arifanyurtlari.netnet14001
estatetime.netnet10001
fotorehber.netnet10001
kalesms.netnet70281
restatetime.netnet11000
akcaabatsebatgenclik.comcom20000
aketmangal.comcom10000
akinsoftperpa.comcom13000
anatolieshot.comcom12010
androidrobotlar.comcom15000
ankarapleksici.comcom14000
babyhipo.comcom8030
babytreemedikal.comcom15000
bakanmetal.comcom10000
banskofirsatlari.comcom16000
beylikduzualkollumekan.comcom22000
bil2sayar.comcom9030
buyukozluinsaat.comcom15000
cadarkakozmetik.comcom15000
cinarreklamtabela.comcom17000
ckbedaselektrik.comcom15000
clinicegzersiz.comcom14000
dadasbilisim.comcom12000
dnzmobilyadekorasyon.comcom20010
ecrinlingerie.comcom13000
eguzhukuk.comcom9000
eksozcukenan.comcom12000
enkarmetal.comcom10000
erdogdusaat.comcom11000
espanoltour.comcom11000
espanyoltour.comcom12000
espanyoltours.comcom13000
espanyolturquiatour.comcom19000
eurostartrade.comcom13001
evimyalova.comcom10010
eyttur.comcom6000
farmasikariyermerkezi.comcom21000
farmasiyeniuyelikformu.comcom22000
garantiotomotivankara.comcom21000
gencisakademisi.comcom15000
gidaisleme.comcom10000
gullupastanesi.comcom14000
guzeldereinsaat.comcom15050
hasbisahin.comcom10000
insaatbeta.comcom10000
istanbulvacationphotographer.comcom28000
izmirtuvalettikanikligi.comcom23000
karabuk-ozgur-yol-yardim-oto-kurtarma.comcom37100
konyapizzaservis.comcom16000
lobiwallpaper.comcom13060
mahlasfikirsanat.comcom16002
mikrotransfer.comcom13000
mikrovip.comcom8001
mirayislamibutik.comcom16000
mobilsesliforum.comcom153800
modernkizlar.comcom12000
musozkanlar.comcom11000
nur-mobilya-boya-tamiri-ankara.comcom30000
ofisurla.comcom8000
optikyildiz.comcom11000
ozelmaya41.comcom10000
ozgeapartpansiyon.comcom17000
ozkanavukatlik.comcom14000
ozyadodondurma.comcom14000
queendilara.comcom11000
ravzadugunkinavehacmagzemeleri.comcom30000
reliancedanismanlik.comcom1929100
sahinmotorsotomotiv.comcom19000
sebatgenclik.comcom12000
sebatgenclikspor.comcom16000
sedefeegzama.comcom12000
sevgiserinkanguzelliksalonu.comcom27000
sirinyasatan.comcom12000
snakevisiongame.comcom15000
sterilifeyikama.comcom15000
takiciamca.comcom10000
temsilcimolkazan.comcom16000
tokatinadresi.comcom13020
turkiyeisveiscirehberi.comcom22100
turquiavocaciones.comcom17000
unlumersintantuni.comcom17000
unlutantuni.comcom11000
vatangonulluleri.comcom16000
yamanolukculuk.comcom14090
yasirkucuk.comcom10000
yeditepehome.comcom12000
ygsyasarteknikmetal.comcom19010
akinsoftperpa.netnet13000
caliskanholding.netnet15002
clinicegzersiz.netnet14000
dergibayi.netnet9000
fikirkoleji.netnet11001
firsatmezat.netnet11001
meydandoviz.netnet11001
mikrovize.netnet9007
mktronic.netnet8023
samirajans.netnet10000
saradent.netnet8044
sedefeegzama.netnet12000
sharingarticle.netnet14000
trabzonlazerkesim.netnet17001
umitokan.netnet8002
hendek54.netnet8000
kulaksizhukuk.netnet13001
mahlasfikirsanat.netnet16002
elityapitasarim.comcom150320
gulumseyenkareler.comcom17070
fenerbahcespor.netnet140396
ekincilernakliyat.netnet17271
letslife.netnet812365
avukatomer.comcom10000
adwordsegitimseti.comcom172150
kastamonusatilik.comcom16060
bitekbendevar.comcom13030
cingozpetrol.comcom12030
celikhantutunuadiyaman.comcom220430
nevsehiravukat.comcom14080
alanyurtelektrik.comcom166100
canlibahissite.comcom14010
dhdantelhome.comcom12010
amercoexport.comcom12030
inmakmetal.comcom10060
forceistanbul.netnet13021
siberpanel.comcom10001
semmajans.comcom9272460
eformaden.comcom9010
holo-gr.comcom7000
renanseckin.comcom110110
yenisenkoleji.comcom13000
yenisenokullari.comcom15000
yenisenuniversitesi.comcom19000
egiysi.netnet6001
sabanozu.comcom8463
sbtskateshop.comcom12010
sabanozu.netnet8353
bacafiltresihavalandirma.comcom24000
biralemtobacco.comcom14040
firsatlargezegeni.comcom17000
istanbulotobeyinci.comcom18000
kaahome.comcom7000
kamelyamert.comcom11000
karbonpeyzaj.comcom12000
kastamonugayrimenkul37.comcom22000
kulturpaketservis.comcom17000
lavendersapanca.comcom15000
satilikkastamonu.comcom16000
tanerkayi.comcom9000
woocommerceegitim.comcom17000
yasamkentfixservis.comcom18110
bacafiltresihavalandirma.netnet24000
hcmedya.netnet7000
karyakarot.comcom10050
pankup.comcom6060
resulkorkmaz.comcom12314750
ekinutkan.comcom9272150
selekspertiz.comcom12323190
asmodagelinlik.comcom141300
bursaetkinlik.comcom13211221
arcelikbekoteknikservis.comcom233550
batmansuperfm.comcom1323311
fulyapeyzaj.comcom111431
cankaya-insaat.comcom140730
sefrestaurant.comcom135110
didimhome.comcom910719340
bilgeyapidenetim.comcom160100
bedavayazici.comcom12421111
dmrconcept.comcom10000
standartgroup.comcom1340435
bucapizza.comcom9295699130
samdanplus.comcom1001141
istanbulhatiralari.comcom186200
seoyoneticisi.comcom13040
marthayvancilik.comcom150100
cepustasi.comcom92170
aysoft.netnet60248
tanco.netnet528538
e-edirne.comcom80250
myhormonelevels.comcom15021
senaryolarim.comcom12960110
anketvar.comcom8380
yalansoyle.comcom100140
alemmagazin.comcom110220
kubilayguner.comcom12040
nesecan.comcom70332
busalsa.comcom711470
londoncoachingsociety.comcom21010
klavuzumkarga.comcom130140
drbeyin.comcom70110
flyingbonus.comcom11010
enucuzsupermarket.comcom17010
borantekstil.netnet121401
alinesin.comcom8081
lokmanhekimankara.comcom170130
mehmetalialabora.comcom1615470
kombistanbul.comcom12389771
esilakuafor.comcom110250
4kmac.comcom5000
infusionsocial.comcom14000
artidegermusavirlik.comcom190150
elektriksirketi.comcom154780
erkanuluca.comcom101100
irfancicekcilik.comcom15180
beautyher.comcom91380
salatatursusu.comcom131156640
hikmetgulay.comcom110110
ozelgrup.netnet80151
suluksatis.netnet10091
renginmobilya.comcom132350
sunguvenlik.comcom111590
fuataytac.comcom9010
makinabirlik.comcom12130
fitlifetr.comcom90120
elektroniksigaraonline.comcom221181140
kiyicaferestaurant.comcom186340
birimgida.comcom9090
azizcanta.comcom9061
likyaoptiksaat.comcom14000
monowl.comcom6000
challanger.netnet10015
yetenekonline.comcom130130
ucuzdaikin.comcom10010
zeybilisim.comcom106310
cindenevinize.comcom13000
pvcsututucubant.netnet15001
arbailetisim.netnet120202
santeoncology.comcom13270
scriptdukkani.comcom130350
antalyadb.comcom90150
anketturkiye.netnet12000
seriamarin.comcom1018170
kollektifisler.comcom14610
marketeko.comcom90131
dokuzoguz.comcom90110
pembebayan.comcom1011470
merayas.comcom70170
bekfit.comcom6000
guzeluyku.comcom9000
mertersu.comcom8000
erginakademi.comcom122160
cmonit.comcom6030
dovmecikartma.comcom138760
informengineer.comcom1433920
tekamobilya.comcom11000
mobilprojem.comcom11080
akdeniz-hukuk.comcom13040
alcipanciustasi.comcom15030
alevinegelsin.comcom13000
asilesarp.comcom9060
ayhanhome.comcom934011
bakicinizburada.comcom150170
bedestenburada.comcom14000
cinhalkcumhuriyetivizesi.comcom24000
degisimsaglikliyasam.comcom20000
dijitalformalar.comcom15000
elincpervariaricilik.comcom20010
erguvanmedia.comcom121206300
estecentral.comcom11000
genelteknikyapi.comcom15010
globistlogistics.comcom16030
goka-der.comcom828470
gorkemgiray.comcom11010
hmrgold.comcom7000
ikibinondokuz.comcom13000
intesmedikal.comcom12020
istebuseker.comcom11000
kactaaciliyor.comcom133630
klavuzukarga.comcom12040
konya-psikonterapi.comcom18020
marborntrading.comcom14010
mobiljet.comcom80114
ngyyapi.comcom7110
ozeldersvekurs.comcom14031
ozlemsisman.comcom11000
acayipgaste.comcom11010
bstservis.comcom90110
cocteylim.comcom97300
evdekitat.comcom9080
evofistadilatdekorasyon.comcom23000
gazzelokantasi.comcom14010
gazzerestaurant.comcom15010
gazzeresturant.comcom14010
ilkeldentl.comcom10000
kosedeizgara.comcom126160
selingumusculuk.comcom15020
yabankusagi.comcom11000
zirozi.comcom6000
milagrotur.netnet10001
ersoytente.netnet10081
tablocini.comcom9000
suyolumerdiven.comcom14000
karliftasansor.comcom14010
aslankilic.comcom10010
sekersoft.comcom9210
akpartiadayi.netnet12001
sevpainsaat.comcom110160
iberpoint.comcom9080
sepetimkapida.comcom130120
ajanmesaj.comcom9020
bantekbilisim.comcom13000
baserkayainsaat.comcom15010
beemattress.comcom11000
buytoptan.comcom9080
cemilbarlas.comcom11010
ddantalya.comcom9010
dogalesmerseker.comcom15000
doktorbeyin.comcom11000
dryazisi.comcom8000
dusyatagi.comcom9000
evldenizliambari.comcom160240
fargensatis.comcom11010
gezenaslan.comcom1014600
goruklehamsipilav.comcom17020
kezibanyorulmaz.comcom15000
kktcdodokus.comcom11000
maximalliraq.comcom12000
maximallstore.comcom13000
mobil-tarifeleri.comcom16000
ortakoyhali.comcom11000
simyairmak.comcom10020
teknikvolkswagen.comcom16010
tibbiyelim.comcom10000
trbrubber.comcom9000
turnomiturizm.comcom13010
yakamozkokorec.comcom14010
yigidosms.comcom9010
ajansms.netnet7000
newshair.netnet8002
sademama.netnet8001
tazegunluk.netnet10001
sentainsaat.comcom110130
sevpayapi.comcom9000
superhizligonderi.comcom17010
vulcainhost.comcom11060
cinhalkcumhuriyetivizesi.netnet24000
gorkemgiray.netnet11000
markaprojeler.netnet13001
saglikafiyet.netnet12001
212plusdoner.comcom12000
adanadadedektif.comcom15000
alformled.comcom9000
ankaradadedektifler.comcom19000
askilepedalla.comcom13000
asyaportgumruk.comcom14000
balayialacati.comcom13000
baysalnevin.comcom11000
bedestensepeti.comcom14000
bimeksguvenlik.comcom14000
bimekssecurity.comcom14000
bimekstechnology.comcom16000
butikterra.comcom10000
craftberk.comcom9000
dentinmoda.comcom10000
dermalinesefakoy.comcom16000
digitalgamelaw.comcom14000
dijitalsporhukuku.comcom17000
dogustrinsaat.comcom13040
ebabilhaliyikama.comcom16000
e-fruittree.comcom11000
enlezletlisi.comcom12000
gorukleplaystationkiralama.comcom26000
hakanaltay40.comcom12000
herbalfitdunya.comcom14090
herkesgezer.comcom11000
ikibin-dokuz.comcom12000
iskanofisi.comcom10010
istanbul212tesisat.comcom18500
izmirotomasyonariza.comcom19070
kadinlarsecer.comcom13000
karinaproje.comcom11000
karmenbardak.comcom12000
lezzetanadoluda.comcom15000
lezzetkurutuyorum.comcom17000
lordanyo.comcom8030
lovefitsamsun.comcom13000
mandalinhaliyikama.comcom18080
mcanakyildiz.comcom12000
mehmetcanakyildiz.comcom17000
mommiti.comcom7000
mumbarci.comcom8000
nihaltunsuzer.comcom13000
onurozy.comcom7000
orienthillspa.comcom13000
ottomananimasyon.comcom16000
oystermantar.comcom12000
perdevekoltuktasarim.comcom20000
pttgumruk.comcom9000
reisogluinsaatmermer.comcom20000
sanayicoffee.comcom12000
sineklikpimapen.comcom15000
sunsapinova.comcom11000
takipetti.comcom9050
tarzimbuyukbeden.comcom16000
tesettursevilince.comcom17000
tevfikkarabulut.comcom15000
uluslararasidownplajfutbolfestivali.comcom35000
vapssacademy.comcom12000
vkbulue.comcom7000
ytechmedia.comcom10000
zeminyapistiriclari.comcom19000
dogalsaglikdernegi.netnet18002
finansalcozumler.netnet16000
kodhikayeleri.netnet13000
myhormonelevels.netnet15001
ofishan.netnet7101
tevfikkarabulut.netnet15000
imarmuhendislik.comcom150151
whyalanya.comcom9000
nedenalanya.comcom11010
gulcehre.comcom837190
teksiselektrik.comcom1452170
emacera.comcom70311
vipmakina.comcom95231
ym34.comcom40141
radyoarmoni.comcom11950
medyumhoca.netnet102121788
karadenizturk.netnet13591
ozeldersler.netnet110424
lysmatematik.comcom12000
avmline.comcom7070
isguvenligifirmalari.comcom201461430
kombicim.netnet823373
atillatezcan.comcom12070
marbrediscount.comcom141210
aeromedya.comcom9000
pamukprensesanaokulu.comcom20180
griftube.comcom8070
hizlivekofteli.comcom1459190
hasakademi.comcom10020
beyazesya-teknikservisi.comcom23050
3dcongress.comcom1075181
kepenktamirati.comcom142160
emrehber.comcom80110
enbutik.netnet7002
cubasetemplates.netnet15211
farkinizolsun.comcom13000
investww.comcom8090
serdeminsaat.comcom12010
imagesyukle.comcom11820860
iosbadres.comcom94130
kansercesitleri.netnet152151
daelimturkey.comcom12090
tuvturkmuayenerandevu.comcom21080
oliwien.comcom7351371
arenaisg.comcom8000
lonnca.comcom649350
businesswisetv.comcom14090
turkdevletleri.netnet14031
egeburomakineleri.comcom178728130
kiteboardalacati.comcom16020
monothings.comcom10060
28mayis2006.comcom110150
antakyabookings.comcom15000
bookinabant.comcom11040
bookingantakya.comcom14000
bookinsapanca.comcom13040
bookintrabzon.comcom13000
bookinuzungol.comcom13001
bookinyalova.comcom12010
emrezuccaciye.comcom132210
eninsaat.comcom89381
magicreklam.comcom11001
mellodika.comcom9002
mimarfatihozen.comcom14010
mybonubon.comcom9000
nevresimimalati.comcom150130
nurteksonlineshop.comcom174120
otelindenal.comcom11000
huncalifeuye.comcom12000
3dkongresi.comcom10174180
alamasli.comcom8081
grifftube.comcom9010
katardaturkavukat.comcom17010
simdisatilir.comcom12000
ucretimukabil.comcom13000
goocell.netnet7002
grifftube.netnet9000
griftube.netnet8000
zerdaokullari.comcom13000
cetinbilir.comcom10040
favoriconcept.comcom13001
bosphorusclinic.comcom15000
toptannevresim.comcom141180
kobicloud.netnet9081
cambalkonsanliurfa.comcom180190
etkinbina.comcom9020
flossiner.comcom9030
kokteylhatti.comcom12010
marbre30x30.comcom11030
marbre30x60.comcom11020
marbre40x40.comcom11020
marbre40x60.comcom11020
marbre45x45.comcom11020
marbre60x60.comcom11020
marbreaccessoire.comcom16030
marbreevier.comcom11020
marbremosaique.comcom14020
marbremural.comcom11220
marbrevasque.comcom12020
memleketindenistegelsin.comcom23000
poolbooth.comcom9000
sandvichatti.comcom12020
sandwichhatti.comcom13020
sebebimwap.comcom103020
sogukmezesepeti.comcom15010
emroozna.netnet8445353
lifelif.netnet7001
savunmasan.comcom10002
sydinci.comcom70260
tr-bonisimo.comcom11000
tr-bonissimo.comcom12000
arzfidan.netnet8001
arztarim.netnet8001
aispool.comcom7000
azerinargile.comcom12000
azerinargiletakimi.comcom18000
bakirnargile.comcom12000
bakirnargiletakimi.comcom18000
cebeanindanakit.comcom15060
dogukanakbaba.comcom13000
elektrikkamera.comcom14000
erdemalptercume.comcom15000
finaluzaktan.comcom12000
finaluzaktanegitim.comcom18000
ismeozeltesbih.comcom14000
istanbulmilletvekiliaday.comcom24000
izmirtvtamir.comcom122700
kurumsalaydinlatma.comcom18000
local-sensation.comcom15000
losensa.comcom7000
metroelektrikelektronik.comcom23000
odailan.comcom7000
ozdenbasmaya.comcom12060
ozkangedikoglu.comcom14000
pacproje.comcom8000
starfidancilik.comcom14100
swift66polo.comcom11000
tesbihmodellerim.comcom16000
uzakrotasummit.comcom14010
warmwalley.comcom10000
anatoliatradecenter.netnet19001
finaluzaktanegitim.netnet18000
serbestcagrisim.netnet15001
cayilcesi.comcom911550
sakaryaforum.comcom121401
salamatcenter.comcom137631
cetinkarabulut.comcom1434910
amirzero.comcom84320
mustafaaslan.netnet120314
cinalisveris.comcom120102
gulbahcem.comcom918180
serdarmaras.comcom1135620
telesave.netnet8153711
womaniranian.comcom12010
shomaresh.comcom9471
54hosting.comcom90700
gulbahcem.netnet9080
filmsiteniz.comcom114980
surinsaat.netnet90113
evdenevenakliyatuskudar.comcom230541
yavuzotolastik.comcom14080
evdenevenakliyatumraniye.netnet240521
atasehirevdenevetasima.comcom224540
current-magazine.netnet160132
globalmt2.comcom90120
city-ville.comcom100280
yenibirfirsat.comcom130210
esyadepolamahizmetleri.netnet223511
sahinprofil.comcom11010
mutluaile.comcom90484
ilimvehayat.comcom11800
ruzgarmetin2.comcom12661
evdenevenakliyatmaltepe.netnet2355521
stilay.comcom6060
evdenevenakliyatkartal.netnet223372
istanbulicievdenevenakliye.comcom262640
tosunogullaritarim.comcom18160
dusline.comcom70240
akasyaevleri.netnet127532
ankara-raydolap.comcom150220
turamt2.comcom71161
heybetlimt2.comcom11000
mohazabnia.comcom108620
shoorparvaz.comcom110360
seykaragrom.comcom11000
azadbet.comcom7000
antalyacam.netnet10002
blumedya.comcom80100
cateringgebze.comcom13010
fanmer.comcom6050
kalinkirtasiye.comcom14147910
marifetlihesap.comcom14010
metselkagit.comcom110200
odak-otomotiv.comcom13020
kurdologyconference.comcom191140
ucuzavilla.comcom10000
yazlikvillaveevler.comcom18000
domainzirvesi.comcom130150
savalangasht.comcom127120
tttaban.comcom74140
onaybank.comcom8040
solespart.comcom9060
academyfamily.comcom13673
fcsgamingtr.comcom11080
jtmuhendislik.comcom13210
turkmega.netnet82981131
isfahanfa.comcom913826461
mmkhirdavat.comcom11030
biostatanalytics.comcom164190
flashkase.netnet9041
iraysan-insaat.comcom14000
berkgruptemizlik.comcom167260
elektroluxservishizmeti.comcom23040
frankeservishizmeti.comcom19050
mieleservis-hizmeti.comcom19000
uygunsunucu.netnet11021
polostargamearea.comcom16130
ateliermasal.comcom12000
blackpapyon.comcom11000
elektroniksaglikmerkezim.comcom24000
radyoakropol.comcom12000
turuncuflat.comcom11000
2acil.comcom5000
beyogluoil.comcom10000
ikiacil.comcom7000
iscilerotokurtarma.comcom18030
supertotobet080.comcom15000
supertotobet090.comcom15000
tekincinarpansiyon.comcom18000
zahreden.comcom8000
zodyak2.comcom7640
beyoglumadeniyag.comcom16000
bordoberelijb.comcom13040
dizayngroupmimarlik.comcom19000
ebaymt2.comcom7000
ezel2.comcom5730
kastamonumericotel.comcom18000
photomediaprint.comcom15000
smdmt2.comcom6000
tahinsepeti.comcom11000
mezemgelsin.netnet11001
currencyage.comcom1148800
telegramn.comcom9001
yatu2.comcom5002
zenon2online.comcom12050
meranofset.comcom1023180
denizcay.comcom80100
gpmimarlik.comcom104320
ciraliflorapension.comcom1817140
gpyikim.comcom7010
ankacup.comcom7000
ces-yapias.comcom10010
cesyapi-as.comcom10010
cesyapias.comcom9010
irmakkent.netnet9002
ozcangurbuz.comcom111100
amalindi.comcom868490
engelpropaganda.comcom1514291560
firmaforma.comcom10022
kayserimeydan.comcom13169741
labradorsalmon.comcom1496770
legalnepal.comcom101554370
libreforum.comcom1067700
salonblueridge.comcom14176440
shantayayoga.comcom120111
estetikkayseri.comcom14010
rinconliberal.comcom130551
yalvactarim.comcom111150
dinamiktercume.comcom142210
kaptanbaba.comcom1011020
bizimkampus.comcom110160
modaahsap.comcom90300
bigbeaverlake.comcom131380
haciendamaya.comcom121740
egemenpansiyon.comcom141200
samsunsinav.comcom114900
eksentercume.comcom121362361
rumbapolo.comcom90170
sodastudio.comcom10117510
dresdenforum.comcom12091
gelincikmoda.comcom12561051
tekinyapim.comcom100220
cundadalyanotel.comcom152370
ayakoizumi.comcom102700
urbanhomeparis.comcom1437370
bireyozel.comcom99110
miamiplan.comcom9091
hurghadamarina.comcom141111160
boluogretmenevi.comcom156490
avonguzellik.comcom12030
enerjipiyasa.comcom120110
taraftargiyim.comcom131260
dogugrup.comcom82101
faithplatform.comcom1325947231
museumfilm.comcom100160
geneculver.comcom1018950
dealname.comcom80130
eminofset.comcom90120
burnettcivil.comcom12092
constantrant.comcom12050
ketchumlegal.comcom12272330
kuntzart.comcom80100
mantistrail.comcom110120
baliasrivillas.comcom1414220
kocaeligiyim.comcom127250
canadabanker.comcom12190
kelebekreklam.comcom130291
beijingfoto.comcom110110
kastamonuozen.comcom1313320
limeplaster.netnet11263655
varan.netnet505937
homesarizona.netnet12121482
princeharry.netnet1102713
abdalhadi.netnet923131
samicouncil.netnet1120250
forumivirtual.netnet131190711
grupdergah.comcom100111
fennimuayene.orgorg12002
dinosaursite.comcom120230
sabanozu.orgorg83163
fanya.orgorg504024
eastwoodtest.comcom122341
apexmetal.netnet90267
giveamanamask.comcom131220
guzelmoda.comcom95230
bronxlatin.orgorg1019171
borctakip.comcom90122
spotcommunity.comcom130290
etiketbaski.comcom110130
novaturizm.comcom100180
saltpebble.comcom10060
sumakeksi.comcom90130
madeiramania.comcom120131
montanagolf.netnet110201
paranormalspot.comcom140140
kapaklikoyu.netnet11287871
handanaydin.comcom111160
vistasana.netnet9002
bilisimkitabi.comcom13081
venusdeal.comcom91390
erenpazarlama.comcom13101
petrolcu.comcom811031
seferi.orgorg60910
iskarta.comcom70240
centremodern.comcom12070
salonaloha.comcom101101
planetbarca.comcom1114713910
kansascitytogo.comcom14050
kotapalembang.comcom13090
globalatlantic.netnet14038
planbeam.comcom83150
hartlandbank.comcom120280
gumuscu.orgorg70147
ogrencitours.comcom120180
nepalartist.comcom112200
barriobros.comcom100180
bizimbaku.comcom91131
kayakmotor.comcom100391
globalatlantic.orgorg14058
angeloajans.comcom110350
gelecekakademi.comcom14090
greendelta.netnet1001415
amalanda.comcom8090
healthygene.netnet11053
modernvista.comcom110170
uruguaycultural.comcom1589141
onurlu.netnet60133
pearltalk.orgorg9012
karicorbett.comcom110181
togoleague.comcom104190
capitalmeal.comcom11020
togosatellite.comcom13490
kosuyolubirey.comcom134220
isteyetenek.comcom110200
jakartamonitor.comcom144130
hurdasanat.comcom105350
entersoma.comcom98230
franciscobros.comcom1393251
johnsonbank.orgorg11056
ondamage.comcom80110
adelinamodel.comcom12141510
romneyrobot.comcom1171150
yasaksite.comcom92591
modernestates.orgorg13004
populerproje.comcom127340
titanwindow.comcom11000
washingtonpark.netnet140129
durakelektronik.comcom157270
craignisbet.comcom116131
namenorth.comcom90100
yogatango.orgorg9042
komurluk.netnet81352
motorhomepost.comcom13030
saraysimit.comcom10051
korkaktavuk.comcom11030
globalminnesota.comcom15091
togoindustrial.comcom146140
togoexecutive.comcom131100
julianhost.comcom100150
pagestat.netnet80172
buyuklugat.comcom100210
kolayzayiflama.netnet140473
ericabrom.comcom9040
irisbilisim.netnet11051
karatebear.comcom100150
molazade.comcom81170
cepheplatform.comcom130140
greatlakestire.comcom140120
excellentrobot.comcom14030
berninisrome.comcom1253130
dijitalatolye.netnet130121
medowlakewaters.comcom15020
pokerstarr.comcom100122
sosyaltrafik.comcom121501
davidmerkur.comcom110110
forumburgas.comcom11164660
fourwaysreklam.comcom142400
tapapizza.comcom96100
pizzagang.orgorg9025
adrestemizlik.comcom130100
cepheasansor.comcom12030
parknepal.comcom90120
beautymask.orgorg100311
entegrepark.comcom11050
annaicatering.comcom13290
aresgayrimenkul.netnet150101
orsatasarim.comcom11000
fiberartisans.orgorg131837351
sadastudio.comcom10010
belgiumfilm.comcom11041
mademondo.comcom9000
deniztemizleme.comcom140130
ciceropatent.comcom123170
umutkose.comcom89281
dogaltakip.comcom104110
etikethane.comcom10062
emiryildiz.comcom10011
panteonroma.comcom11030
metaajansreklam.comcom150350
patiforum.comcom9100
pardonpatron.comcom12010
karavanturk.comcom110100
skorlink.comcom8070
pulastar.comcom8000
manueltama.comcom104370
sinemahayat.comcom1110690
trafikreklam.comcom123113
echototo.comcom8000
tuemplast.comcom90180
alessami.comcom8082
arcachonvilla.comcom13070
soloduka.comcom8370
annequinlan.comcom11070
penrithgolf.comcom110192
mercimade.comcom9000
marspartner.comcom11000
apkakart.comcom80170
trabzonturkey.comcom13334110
laratalk.comcom8010
perdepark.comcom90110
sodasale.comcom81170
powderpilot.comcom11071
salonchateaudun.comcom1541380
elazigambalaj.comcom13310
uyusma.comcom6011
profilefor.comcom10010
zamanbatu.comcom9020
annesanger.orgorg10041
captaincheck.orgorg12061
genchafiza.orgorg100100
genebeer.orgorg8051
gracevalleyperu.orgorg15060
kentbradley.orgorg11362751
markervideo.orgorg11062
qatarpetrol.orgorg11081
sogukdemleme.orgorg12071
vidamina.orgorg8001
silodepo.comcom8030
alanyabitpazari.comcom15090
alfaromeoprice.comcom140130
almopetrol.comcom10040
arcensite.comcom90130
arkansaslogos.comcom13000
babaannekres.comcom12010
basketsurprise.comcom140120
betonkirimkesim.comcom15080
bishopsglobal.comcom13010
brisbanesalon.comcom130140
bryandangelis.comcom13010
caspermodel.comcom110270
clearviewplan.comcom130110
crystalmarina.comcom13092
downeylink.comcom100210
enerjiproje.comcom11011
erikburton.comcom10071
esenyumurta.comcom11030
fermantabela.comcom1212450
fethiyebisiklet.comcom150270
forumeritrea.comcom12040
futuristchina.comcom13020
granataroma.comcom11010
granitiran.comcom104460
hangitercih.comcom11000
harrisonvideo.comcom13090
hillarik.comcom8010
hukukistihbarat.comcom15000
illegalcommerce.comcom1541310
illegaldeal.comcom113320
ismetyildiz.comcom11010
lambertgolf.comcom11060
logansans.comcom9080
lovelyself.comcom10000
magnaklip.comcom9020
mazotkoruma.comcom11431
menzilmobilya.comcom130240
mersindugunevi.comcom14020
metropolproje.comcom131350
modaunited.comcom10010
moonstardubai.comcom13010
murphymodern.comcom12010
nasilarac.comcom9000
panoparamanga.comcom13290
pepeponce.comcom9050
diyaregypt.comcom101190
kentreese.comcom90310
ozenvence.comcom9120
startersvalley.comcom14023
akillinumara.comcom12020
americandumdum.comcom14020
amigochino.comcom10020
ankaralli.comcom9030
artistlikyapim.comcom14020
bereketromork.comcom13000
halekalaheo.comcom11030
kellycooksalon.comcom14020
kizilsahin.comcom10010
okkapontianak.comcom13020
sahihain.comcom8070
saukcentrepizza.comcom15010
scottcastlesart.comcom15340
artistikyapim.netnet13001
artistlikyapim.netnet14000
civilyapi.netnet9171120
esirmalta.comcom9020
edenmedical.netnet11004
crystalgene.orgorg11071
pastaunited.orgorg11070
konakdedektor.comcom13490
mariarosamartin.comcom15420
hassasdaktilo.comcom13010
agoradatca.comcom10010
donetemizlik.comcom12010
traplead.comcom8000
totogram.netnet83101
baronbrooks.netnet11040
hindislogan.comcom1180100
yogavenus.comcom9001
trenbaza.comcom8000
galatasti.comcom9000
lasoporte.comcom9000
delikindonesia.comcom141150
kedikulubesi.comcom12010
spormetre.netnet9012
studyoplaza.comcom11000
salonadel.comcom94151
urbanarenas.comcom11020
windowmoment.comcom12010
altafiber.comcom9020
minigolfcenter.comcom14421
veronature.comcom10020
ermisadam.comcom90170
bittermagnolia.comcom14320
biranburada.comcom11020
caminomania.comcom11010
marshillstore.comcom13000
metinesenturk.comcom13000
petalumapolice.comcom14011
radfordtest.comcom11921
tampamodernhome.comcom15010
alisdairclark.comcom13030
anapolisglobal.comcom14021
belgiumkelepir.comcom14020
coronamusgrave.comcom14010
dekordetay.comcom1031230
elifpijama.comcom10010
enterpunt.comcom9010
gebzelazerbaski.comcom15020
genestaples.comcom11030
havlubikini.comcom11010
hilalkaraman.comcom12010
kuruking.comcom8010
lakesidefarmer.comcom14000
markoshana.comcom10010
massagebeloit.comcom13120
partnergram.comcom11001
resimbayrampasa.comcom15010
resimesenyurt.comcom13020
resimfatih.comcom10020
resimsilivri.comcom12020
resimsultangazi.comcom15020
saltyamerica.comcom12010
selvasanta.comcom10030
tasayapi.comcom8010
utopiapeyzaj.comcom12120
beertrails.netnet10004
kemmerermail.netnet12000
liftiran.netnet8062
resimadalar.netnet11001
resimankara.netnet11001
resimarnavutkoy.netnet15001
resimatasehir.netnet13001
resimbakirkoy.netnet13001
resimbasaksehir.netnet15001
resimbayrampasa.netnet15000
resimbesiktas.netnet13001
resimbeykoz.netnet11001
resimbeyoglu.netnet12001
resimesenyurt.netnet13000
resimeyup.netnet9001
resimfatih.netnet10000
resimizmir.netnet10001
resimkadikoy.netnet12001
resimkartal.netnet11001
resimpendik.netnet11011
resimsancaktepe.netnet15001
resimsariyer.netnet12001
resimsile.netnet9001
resimsilivri.netnet12000
resimsisli.netnet10001
resimsultangazi.netnet15000
resimtuzla.netnet10001
resimumraniye.netnet13001
bakanakliyat.comcom12010
hilafetyolu.comcom11010
sinavkaynarca.comcom130350
emiryapiinsaat.netnet14001
hibeglobal.comcom10020
elementdate.comcom11000
flixiran.comcom8040
erkekliknedir.comcom13050
fiskekart.comcom9010
idilayakkabi.comcom12110
underwoodglobal.comcom15000
tapontalent.comcom112180
pittsburghbeer.comcom1415470
vietnamgates.comcom12020
thomaslens.comcom104120
stokelektrik.comcom12000
kingsparklegal.comcom14011
planindustry.comcom120110
plannigeria.comcom11050
potterenglish.comcom13010
sunshineharry.comcom13080
toreside.comcom8010
bakavirus.netnet9000
chinapatentrust.netnet15003
londontogo.netnet100252
masakonikuma.netnet120101
miamiglobal.netnet11012
pinarhanim.netnet10012
sabahcocuk.netnet10001
salatura.netnet8001
zevkalin.netnet8011
studyoaksu.comcom1026200
izmirbizim.netnet100140
engelssaft.orgorg10000
hamifile.comcom8000
ripleytest.comcom10000
artisalliance.comcom13000
edencovesale.comcom12000
elbiseerkek.comcom11030
generalcircle.comcom13000
greenstanker.comcom12000
helalburs.comcom9700
idealshadow.comcom11000
lucaslime.comcom9000
metasecond.comcom10000
postalpano.comcom10000
wondermason.comcom11000
helalburs.netnet9900
minebasis.comcom9090
basisbanks.comcom100120
agoracachan.comcom11000
ameslakeestates.comcom15000
antoniocanta.comcom12000
banaozeldaire.comcom13000
banauygundaire.comcom14000
barknashville.comcom13000
czechiahost.comcom11000
ennamoda.comcom8000
gezginpapagan.comcom13000
ideallovely.comcom11001
indensure.comcom9000
kadikoykokorec.comcom14000
kayasolo.comcom8000
lombarking.comcom10000
meltemkule.comcom10000
motorbikespost.comcom14000
neersalon.comcom9000
ninetyninetours.comcom15000
nuvester.comcom8000
sofagarcia.comcom10000
turkeygumus.comcom11000
turkhenry.comcom9000
vizyonveri.comcom10000
yemyesilpetrol.comcom14000
zahirhome.comcom9000
zenginpark.comcom10000
basiscoin.netnet9005
fireenterprise.netnet14001
samsuntesisat.netnet13003
marklorch.orgorg9001
brandrevu.comcom9001
cottonfiberwood.comcom15000
dijitalkalpazan.comcom15000
doneklaim.comcom9000
echosierratango.comcom15000
edepgumustesbih.comcom15000
karalahmacun.comcom12000
martinhayn.comcom10000
sakabeauty.comcom10000
somaregen.comcom9000
subedeniz.comcom9000
brandrevu.netnet9001
orangutancoin.netnet13002
avrupalazer.orgorg11001
brandrevu.orgorg9001
fireshaker.orgorg10001
jaguartoto.orgorg10015
karamiami.orgorg9001
wildwoodyoga.orgorg12003
aylawood.comcom8000
bekabishop.comcom10000
tavantest.comcom9000
bababazuka.comcom10000
grevotel.comcom8000
manidivani.comcom10001
meetingburo.comcom11000
amazonechorobot.comcom15000
amazonfirerobot.comcom15000
yamasale.comcom8000
devrimciyarin.netnet131110
artistzaradavid.comcom15000
apolloboya.comcom10000
novawallform.comcom12000
galaxlink.netnet9001
championmeal.comcom12000
franksaga.comcom9000
nakalikit.comcom9000
zwaagstrabeton.comcom14001
pauldaramola.orgorg12001
lourdesanne.comcom11000
murekkepmedia.comcom13000
salasasasasa.comcom12000
fenerkultur.comcom11000
futatsuyama.netnet11001
definkreuzberg.comcom14001

Dün ve daha önceki günlerde düşen alan adlarını linkte bulabilirsiniz: Dün Düşen Domainler

Uzantı alan adlarını uzantı türüne göre bu bölümde görebilir ve tablo sıralamasını bu sütündan değiştirebilirsiniz. Eğer sadece COM uzantılı adresler ile ilgileniyorsanız aşağıdaki tabloda “Bul” kısmına “.COM” yazmanız halinde sadece bu uzantıya sahip adresleri görebilirsiniz. Sitemizde sadece önde gelen 3 uzantıya yer veriyoruz. Bu kısımda .NET ve .ORG uzantılarını da aynı yöntem ile listeleyebilirsiniz.

Uzunluk bu sütunda alan adlarını karakter sayısına göre küçükten büyüğe yada büyükten küçüğe doğru sıralandırabilirsiniz.

Backlink sayısı alan adının sahip olduğu toplam backlink sayısıdır. Maalesef internette düzgün çalışan API bulmak çok zor olduğu için bu verilerimiz güvenilir değildir. Eğer backlink değeri için alan adı alacaksanız lütfen kendiniz de adresi sorgulayınız. Tablomuzdaki veriler yüzde yüz doğru değildir bu sütunumuzda.

Archive sütununda adresin archive.org sitesinde yer alan kayıt sayısını görebilirsiniz. Domainin daha önce hangi kategorilerde ve aktif olarak yayın yapıp yapmadığına dair bu bölüm fikir vermektedir.

Son Kayıt sütununda adresin bilinen en eski kayıt tarihi yer almaktadır. Domainin geçmişi için önemli bir kriterdir.

Toplam Kayıt sütununda ise com, net, org gibi kaç farklı uzantısının kayıtlı olduğunu görebilirsiniz.


Satılık Alan Adları

Haftanı popüler webmaster forumları ve domain platformlarında devam eden açık arttırmaları ve hemen al fiyatlı satışlarını aşağıdaki listemizde bulabilirsiniz.

Listemiz sürekli güncellenecektir, alan adları ile ilgileniyorsanız lütfen yazımızı hafta boyunca takip edin !

Açık arttırmada olan alan adlarının isimlerine tıklayarak satışın yapıldığı sayfaya gidebilirsiniz.

İlgilendiğiniz Adresler İçin Linteki Bağlantıdan Bize Ulaşabilirsiniz: Domain Satış

DomainKategoriFirmaKayıtBitiş
hiyeroglif.comJenerikNameBright20162020
kofa.netCVCVGodaddy19982020
sosyaluzman.comWebmasterNamebright20182020
sosyalasistan.comWebmasterIonos20192020
iletisim.orgGenelGodaddy20012020
kocaelihaber.orgHaberGodaddy20072020
etkinhaber.comHaberNamebright20072020
ressam.netGenelGodaddy20022020
beyler.netGenelGodaddy20002020
firmalar.orgE-TicaretGodaddy20062020
mp3indir.orgGenelGodaddy20032020
guzelseo.comWebmasterGodaddy20192020
ucretsiztema.comWebmasterNamebright20192020
seoscore.netWebmasterGodaddy20172020
adanaliyik.comGenelNamebright20152020
muhi.netCVCVHostingcomtr20192020
pezu.netCVCVNamesilo20192020
vohe.netCVCVHostingcomtr20192020
levu.netCVCVHostingcomtr20192020
kevu.netCVCVHostingcomtr20192020
luhi.netCVCVHostingcomtr20192020
gihu.netCVCVGodaddy20192021
pevu.netCVCVHostingcomtr20192020
gundem724.comHaberGodaddy20192020
mangir.netCoinHostgator20172019
zerzevat.netGenelGodaddy20112019
gorselarama.comGenelGodaddy20182019
gorselbilgi.comGenelGodaddy20192020
aranmahacmi.comWebmasterGodaddy20192020
ozgunyazi.comGenelGodaddy20192020
bagcilar.coİlçeGodaddy20192020
gaziosmanpasa.coİlçeGodaddy20192020
sariyer.coİlçeGodaddy20192020
kagithane.coİlçeGodaddy20192020
catalca.coİlçeGodaddy20192020
buyukcekmece.coİlçeGodaddy20192020
gungoren.coİlçeGodaddy20192020