18 Temmuz 2019 Perşembe düşen domain (alan adı) listelerini yazımızın devamında bulabilirsiniz.

Domainlerin düşeceği gün, en geç saat 17.00-18.00 saat aralığında günün listesi sitemize eklenmektedir.

Facebook’ta Takip Et, Listeler Eklendikçe Haberin Olsun: https://www.facebook.com/isimyakala/


Domainler Ne Zaman Saat Kaçta Düşecekler?

Alan adıları yıllık olarak satın alınmaktadır ve eski sahipleri tarafından yenilenmediklerinde boşa düşerek tekrar satın alınabilir hale gelirler.

Farklı uzantılara sahip alan adlarının bugün akşam hangi saat araşığında düşeceğini linkteki yazımızda görebilirsiniz. En çok takip edilen .COM ve .NET uzantılar akşamları saat 20.30’dan sonra düşmeye başlamaktadır. Aşağıdaki listelerdeki alan adları bugün akşam düşecektir henüz düşmemiştir ! Detaylı bilgi için: Domainler Ne Zaman Boşa Düşer

18 Temmuz Bugün Düşecek Alan Adları

Aşağıda kategorilere göre ayrılmış alan adlarının bir kısmını görebilirsiniz. Bugün sizler için seçtiğimiz alan adının tam listesini yazımızın alt bölümlerindeki tablomuzda görebilirsiniz.

Jenerik domain önerileri;

Jenerik alan adları bölümünde TDK Sözlük anlamlı düşecek alan adları listelenmektedir.

actirma.com
afgan.net
agircekim.com
aglasun.com
altyazi.info
baglik.com
balgam.org
balikyagi.net
balikyagi.org
bankacilik.net
belbel.info
bork.info
bozma.net
cupra.info
degin.info
duyumsuz.com
frigorifik.net
gomme.org
guroymak.org
hatirat.net
istop.info
kamu.tv
kefen.org
kitirci.com
konuk.org
kozmos.net
kutuk.org
laboratuvar.org
manali.info
nahir.org
nazist.org
sahilkoruma.com
sokun.net
sudegirmeni.com
sukran.net
tutulusatis.com

18 Temmuz Düşecek Domainler Listesi

Aşağıdaki listedeki bul kısmına bilgi, sağlık, araba, haber, tekno, ekonomi, kadin, indir, tatil, emlak, bilet, kripto, sohbet, yemek, bebek, kitap, hediye, moda, oyun, sigorta, kredi, indir gibi kelimeleri yazarak sadece o kelimenin geçtiği alan adlarını görebilirsiniz.



DomainUzantıUzunlukBacklinkArchiveSon KayıtToplam Kayıt
indirdown.comcom9324727720060
emlakscript.comcom1108820170
haberpotasi.comcom114710220080
emlakkonutarsa.comcom1401020150
kitapzamani.comcom111420151
prgbilgisayar.comcom13192820180
oyunyazilim.comcom11201620180
arabapar.comcom801620180
biletturkiye.comcom1282720160
uzmanvize.comcom902320183
uzmanarastirma.comcom140020170
turkiyemlak.netnet1133720171
tunabilgisayar.netnet1411020182
viphaber.netnet81211420072
kalitelioyuncak.comcom1504820140
sohbetderyasi.netnet131301320181
dogumgunuhediyeleri.comcom1915220081
ikikisilikoyunlar.orgorg17617220185
bedavaoyunindir.orgorg1519110420124
konyachatsohbet.orgorg151443720171
emlaksiteniz.comcom1201920180
melihemlak.comcom1001820180
bilgikitap.comcom1011920171
tr-emlak.comcom80520180
yemeklink.comcom901920170
karatasogluemlak.comcom161720180
maryooyunlari.netnet13102820181
forekshaber.netnet1101120141
karmaemlak.comcom1069820180
teknocilingir.comcom130020180
habertrakya.netnet1101320181
ensonhaber7.comcom1186420180
yanginhaber.comcom110220180
kistatili.netnet911020181
malatyahaber44.comcom14924213420180
bilisimuzmani.orgorg1311620135
anketuzmani.comcom110020180
ilginchediyem.comcom1301020180
szhuoyun88.comcom100220180
haberav.comcom701820180
teknogel.comcom8305320141
ucakbiletfiyatlari.netnet1802520124
obihaber.comcom81620180
sosyalemlak.comcom1101520122
dietasparabajardepesos.comcom22222620110
oyunbolumleri.comcom1386820160
ozersigorta.netnet1102820161
facebookhaberler.comcom160820160
istekno.comcom70620180
habersondakika.orgorg14186320187
emlakbilgileri.comcom1412420180
esyasigortasi.comcom1302220120
tatilway.comcom87029620180
forexekonomiktakvim.netnet190920140
kubilayemlak.comcom1201520180
teknomekan.netnet102283720180
ekonomikuc.comcom102520180
serhatbilgin.comcom120120181
darcinemlak.comcom1102920130
haberalt.comcom803020180
haberarastirma.comcom1401020100
uzmanotoanahtar.comcom1513320110
rakunkitap.comcom1003220120
mersinbilisimbilgisayar.comcom2341720170
gulyapiemlak.comcom1201320140
doorsemlak.comcom1001720160
doorsemlak.netnet100020160
haoyunhaoyun.comcom120820180
arnavutkoyemlakilanlari.comcom23251720140
teknotax.comcom80820170
houzmanager.comcom110020180
habercibaykus.comcom130020180
esyasigorta.comcom110020180
kapadokyatatil.orgorg140720182
buyukcekmecevizyonemlak.comcom237520140
haoyunfw.comcom825702120160
oryonhaber.comcom1002020140
habervegazete.comcom130720180
btuzmani.comcom8301620181
yemekche.comcom80520170
gelisimoyunlari.comcom1501620180
cetineremlak.comcom1222120181
kocallianzsigorta.orgorg174504520011
koskemlak.orgorg91520182
teknoyorum.orgorg100020132
bandirmaemlakgazetesi.comcom2101820180
bilgigalerisi.comcom130420170
cetinemlakaksehir.comcom170620150
eliaoyun.comcom80020180
emerikadaemlakyatirimi.comcom2201120080
emlakarsakonut.comcom140620150
krediev.comcom701020180
kredisonuc.comcom100020180
larababa.comcom80920110
mercadoguzmanelbueno.comcom20201320111
oyunlar8.comcom803620180
airlinesbilethatti.comcom1801220160
teknolojihaberioku.comcom180620180
hindireading.comcom120020180
hediyemcocuklara.comcom161420180
muratarabangkit.comcom1502420180
portaloyunsanati.comcom160220180
akpinaremlakbursa.comcom170220170
teknoturk4.comcom100920170
kestiremlak.comcom110220170
organikannebebek.comcom160020170
hansedteknoloji.comcom150020171
motohediye.comcom100020170
hansedteknoloji.netnet150020171
forexindir.netnet100020140
silifkemucitemlak.comcom1701620130
taskredi.comcom80220180
aracsigortasihesaplama.netnet220020180
cintatile.netnet90020140
pozitifemlakgyo.comcom150220181
guzelcanlisohbet.comcom160120180
hottersohbet.comcom120120180
ucakbiletijet.comcom130020180
finans-haberleri.comcom160020180
bhteknologi.comcom110020180
denizlisatilikmagaza.comcom200020180
tamashabera.comcom1166020180
yapikredi-bireyseliislemler.comcom274020180
azhediyelik.comcom110820180
biletero.comcom80020180
bilgilic.comcom80020180
bilgiteknolojileridevrimi.comcom250020180
bursaisikbilgisayar.comcom190020180
goldenmaskindirim.comcom170020181
goldenmaskmagaza.comcom160020180
gshaber1905.comcom110020180
gundogdubilgisayar49.comcom200020180
hediyemarkettr.comcom140720180
kasitatilogistics.comcom170020180
kybelemagaza.comcom120620180
liaoyunnian1994.comcom150020180
mercanlarhaber.comcom140020180
v-bilgisayar.comcom120020180
vodatechsigorta.comcom150020180
yesilbursahediye.comcom160020180
8150habershamwatersrd.netnet210020180
mgteknology.comcom110020180
saglamemlakcim.comcom140020180
habervegazete.netnet130020180
habervegazete.orgorg130020180
asistancesigorta.comcom160020180
asistanssigorta.comcom150020180
bursbilet.comcom90020180
emekliyekredicikartilir.comcom230020180
farmasibilgial.comcom140020180
fultatil.comcom80020180
gizemlioyuncak.comcom140020180
habercikusu.comcom110020180
ikssigorta.comcom100020180
kitapabonesi.comcom120020180
kredinotunugor.comcom140020180
lacostindirimleri.comcom170020180
mersinbiletal.comcom130020180
skylanduzmani.comcom130020180
tekno666.comcom80020180
uzmankredidanismanlik.comcom210020180
winsesemlak.comcom110020180
kitapabonesi.netnet120020180
kitapmutalaasi.netnet140020180
nevaemlak.netnet90020181
kitapabonesi.orgorg120020180
xiaioyunjd.comcom100020180
eliaoyun.netnet80020180
luxgelinarabasi.comcom150020180
qnb-mobilgiris.comcom140020180
dt-gaming.comcom913020183
kalbimdekises.comcom1301320180
partnermatbaa.comcom13113420170
orjinalotoyedekparca.comcom200820180
melisayufka.comcom110520180
avcilardayiz.comcom12372120170
batimusavirlik.comcom1442420170
gemlikterminal.comcom14186520090
doganinsaatltd.comcom140620180
bozkiryenikoy.comcom1303020150
efeninsesi.comcom1002120140
katproduksiyon.comcom14174120130
bulgotur.comcom80120170
agircekim.comcom919220131
samsungaw.comcom921220170
alimmedikal.comcom1162220161
ikincieltekstilmakinalari.comcom252911020180
chatduragi.comcom10203520170
kayagaz.comcom702120120
evselaritma.comcom1101420170
ademcilek.comcom911420180
gec3.comcom401820182
sisajans.comcom8452520180
yigitlergrup.comcom1201620171
milletspor.comcom100520180
e-bakici.netnet83619620181
xizle.netnet514220184
stajyeri.netnet801220182
ankaratabela.netnet1204320137
sanaleczane.netnet1101920182
ozaypaslanmaz.netnet130820181
bahcelievlerevdenevenakliyat.netnet2818703420173
basaksehirevdenevenakliyat.netnet2618703820174
pendikevdenevenakliyat.netnet2218702620177
sariyerevdenevenakliyat.netnet2318735220176
kefen.orgorg501520189
konuk.orgorg501420189
ilanmilan.comcom902320180
rusca-turkce.comcom120020180
gozlemdergisi.comcom1301120170
sanalfm.netnet702120182
ozelev.comcom601920140
sesliinci.comcom902920180
sosyalmedyareklamciligi.comcom2302820140
chatdelisi.comcom1024324020171
balgam.orgorg663220164
bossepet.comcom80520180
zeytinyagimiz.comcom130620180
chatciyiz.comcom921920170
limanpansiyon.netnet130220181
beyogluevdenevenakliyat.netnet231870520173
laleliklimaservisi.comcom1812220180
luksdekor.comcom972420122
lensyapim.netnet90220181
goodholiday.netnet11011201816
primevit.comcom80520182
holiclub.netnet81120181
turkce-rusca.comcom120520180
autoaksesuar.comcom120220181
autoaksesuar.netnet120020181
samimakina.comcom100820180
eczaborsasi.comcom110020180
yucelsuarmaturleri.comcom181022116020160
turkcedublajfilm.netnet1645520162
cast-ajans.comcom1024120170
sekerdiyari.comcom110620181
nursekerleme.comcom120620180
batiymm.comcom70620171
mbcinsaat.comcom90020180
liderambalaj.comcom1211120122
sorgulamatc.comcom1133420120
kabecanli.comcom912020130
herseycokucuza.comcom1402920180
beyazyapi.orgorg903820135
teenspic.comcom806319992
doktorcati.comcom100120070
karasupromosyon.comcom1522820180
sultangazievdenevenakliyat.netnet2618703320172
yankielektronik.comcom1502720140
cagataytemizlik.comcom150020180
rizamete.comcom80020180
yenibosnademirdokumservisi.comcom260920181
proyapim.comcom8321720170
sariyerevdenevenakliye.comcom224733020152
peysaj.netnet693520165
heybec.comcom643120180
basariisitma.comcom125220181
telefonkaydi.netnet1294920140
guroymak.orgorg833320165
crestturkiye.comcom120020180
sanalturizmir.netnet130920131
budomain.netnet80420181
tasarimpro.comcom1001020180
gecelikci.comcom902520180
pvpserverlerin.comcom1401220180
klimaservisifatih.comcom1712220180
proxilyt.comcom811120180
postaseriilan.orgorg130620103
kadikoymuhendislik.comcom1801320180
cerkezkoyevdenevenakliyat.orgorg2501220133
briketmakinasi.orgorg1402620142
defnedizayn.comcom1102720180
cetinnakliyat.comcom1321620182
ncmbaver.comcom801520170
senkronyapi.netnet1171620112
konyadermanhacamat.comcom18182720130
dsmartportal.comcom120220180
piratik.netnet701020182
baskilikolibandi.netnet166120181
sutsat.comcom601420170
fulltimeholiday.comcom1501120181
seslihis.orgorg80120164
catiolugu.comcom923820140
sefireialem.comcom1101120141
sefireialem.netnet1103820141
parfumzen.comcom90120170
sidemder.comcom80720140
delirdikchat.comcom120420180
sonnota.netnet70020180
sonnota.comcom70620180
cekmekoymedya.comcom130020180
ivfcentre.orgorg90920157
islammuzesi.comcom110020140
taraklidatermal.comcom150620180
ozisikmakine.comcom120020180
atasinsaat.comcom1011220161
silesatilikarsa.netnet150020151
adalarevdenevenakliyat.netnet221873020170
ercissecim.comcom100920180
mandalfilm.comcom1001120180
okansimsek.orgorg100220160
tesisatkadikoy.comcom140020180
eksizolukfiyatlari.comcom1821252320140
formulaz.orgorg801620155
cicibicidukkani.comcom1501120150
imariskan.comcom90420180
polimerkanal.comcom1201120160
implantcapillaireprix.comcom210920171
pvczeminkaplamaustasi.comcom2101820160
neromedya.comcom90520180
mersinguvennakliyat.comcom191220140
umutkablo.comcom911120120
adasitesi.comcom901320120
aktuelalanya.comcom1224220150
serhatkasap.comcom110120151
videomp4.orgorg8127201710
firatakademi.comcom12544220120
cimtepeturizm.comcom1314020180
secim25.comcom72931920180
sirinseylerureticisi.comcom203267120130
formabizde.comcom1001720170
holiclub.comcom821420181
keykompresor.comcom122020180
ijmes.orgorg50020173
gitarogrencisi.comcom1467212520150
tesaryapi.comcom90220180
thyacilkargo.comcom120620180
oriongida.comcom902820180
holitime.netnet80020186
fotografnagme.comcom130120160
nissansikayet.comcom130020180
birincioptik.comcom1201820120
changeali.comcom90020180
saattasarim.comcom110220160
akkonklima.comcom100120171
kervantelorgu.comcom132320180
beybeyinsaat.comcom1204020160
zeytinyaginiz.comcom130020180
cprilkyardim.orgorg120720141
hbx-2371.orgorg80720150
kalendergayrimenkul.orgorg190020152
luleburgazevdenevenakliyat.orgorg260020132
sosyalsorumlulukprojesi.orgorg2301520134
kocaelimhp.orgorg100020181
turcash.orgorg70920141
444vaillantservisi.comcom180820170
444viessmannservisi.comcom190920170
akifaksu.comcom81120180
alisveriskapisi.comcom1501020180
arizabildirimi.comcom1414478220180
arti2gayrimenkul.comcom1601220140
barigrup.comcom842920150
besantour.comcom91320170
birincihastanesi.comcom160120120
boncuksackaynak.comcom150320121
cekmeoluk.comcom901120140
cozumegitimde.comcom130120150
designmakina.comcom120020180
digibayileri.comcom1201720150
doktorcephe.comcom110120070
dokumayaklar.comcom120020180
dunyayasam.comcom102020180
e-muhendis.comcom1001520181
elektronikprojetasarimlari.comcom2601920150
erkayyavuz.comcom100320130
estetikjantlastik.comcom1701020180
eydogroup.comcom902020120
eydoor.comcom601120120
manisailaclama.orgorg1401420162
garpark.comcom71020172
greffedecheveuxprix.comcom190120170
ibaytr.comcom60720120
implant-cheveux-turquie.comcom230120170
iyiadaylar.comcom100020181
kadinarti.comcom90720130
kelinyeri.comcom90720180
konteynerfirmalari.comcom1862620180
markastant.comcom104120180
masajsalonumutluson.comcom1901920181
mersinfasil.comcom115113320180
mkmaket.comcom70320150
mustafasandikli.comcom1502020110
nemsesyalitim.comcom130320180
omerozcancelik.comcom140120140
pasalartermal.comcom1302220181
plastikenjeksiyonkalibi.comcom2301720160
servetbedir.comcom110020180
abyorganizasyon.orgorg150620162
idrakder.orgorg80020160
ottomanclean.orgorg120220160
segaisgm.orgorg802120160
seyrorganizasyon.orgorg160620161
acesomedikal.comcom120120160
alcazbunu.comcom90120160
altinorancetveli.comcom160120160
anilaltintas.comcom120120160
askatolyem.comcom100320160
balonvitrini.comcom1201420160
betlayn724.comcom1018020160
biberoncum.comcom100420160
bursaatlasevdeneve.comcom1801120160
filipinlergezi.comcom1493620160
filmalti.comcom801220161
galipkilinc.comcom110020160
ilan56.comcom60120160
irhayapi.comcom80820160
isiksoynakliyat.comcom1552920160
kozmikenerjiegitimi.comcom190020160
kozmikenerjisinedir.comcom190020160
pazarmidyat.comcom110120160
polimerkanali.comcom130520160
revizyonakademi.comcom150320162
riseofnature.comcom120420160
troteli.comcom70020160
turkoteli.comcom90020160
ustamirci.comcom90120160
askatolyem.netnet100220160
cimcati.netnet70020161
gulistanorganizasyon.netnet2001520161
okansimsek.netnet100020160
serafettinyavuz.comcom152820181
begeniservisi.netnet1315020151
proxysorgula.netnet120020182
tendaotel.comcom90020180
sesliserenay.comcom1201720180
myratarim.comcom90020180
bakicihizmeti.netnet130720182
vedatepesi.comcom100520170
metecagdas.comcom100020180
sigaratesti.comcom110720180
seslidunyamobil.comcom150420171
rodoskapivizesi.comcom150020180
adiyaman4004.orgorg1254120170
pazzarola.orgorg90020170
3dinsaatmodelleme.comcom170320170
444kombi-servisi.comcom160120170
444mieleservisi.comcom1501520170
akefilo.comcom70220170
alternatiftedavilermerkezi.comcom260120170
ankaracokseslikorosu.comcom200020171
ankaraotocekme.comcom140120170
arttirilmisgerceklikturkiye.comcom270120173
aybbinsaat.comcom100520170
barbarostayfun.comcom140120170
batibagimsizdenetim.comcom190120170
baytematikyag.comcom1301220170
beratemreileri.comcom140120170
bodrumbahcivani.comcom150120170
bucakilahigrubu.comcom150120170
cemelektrikankara.comcom1701620170
corluhaliyikamacilar.comcom201120170
endogalgidalar.comcom140120170
enesaygen.comcom901020170
faikbezek.comcom90120170
filgorukle.comcom100120170
goatmilkfood.comcom120120170
greffe-de-cheveux-prix.comcom220120170
greffecheveuxprix.comcom170120170
gulsoyotokurtarici.comcom1804920170
guvenligeridonusum.comcom180020170
hanedantatli.comcom120120170
iklimsakonyabayi.comcom160120170
implant-capillaire-cliniqu.comcom260120170
implant-capillaire-en-turquie.comcom290120170
implant-capillaire-istanbul.comcom270120170
implant-capillaire-prix.comcom230120170
implant-capillaire-turquie.comcom260120170
implantcapillairecliniqu.comcom240120170
implantcapillaireenturquie.comcom260120170
implantcapillaireistanbul.comcom250120171
implants-capillaires-turquie.comcom280120170
implantscapillairesturquie.comcom260120170
inegolummobilya.comcom150120170
kabakname.comcom90120170
karelmecidiyekoy.comcom1620220170
kibrissivamakinasi.comcom180020170
kibrisstanmak.comcom130120170
kilifdakilif.comcom120120171
kombinmobilya.comcom130420170
konutendeksim.comcom130020170
kucukcekmecegultepeasm.comcom220720170
leventyaz.comcom90120170
menkadanismanlik.comcom1601320170
navmobilya.comcom1001520170
optimumyayinleri.comcom160120170
oziduvarkagidi.comcom140220170
payitahtgazetesi.comcom160020170
sanlidagnakliyat.comcom161184220170
seydikemerata.comcom130120171
storeoptik.comcom100020170
trainedtobebad.comcom140120170
turquie-implant-capillaire.comcom260120170
turquieimplantcapillaire.comcom240120170
yildirimyapimakina.comcom180120170
ymaratyolhk.comcom1151120170
ankaracokseslikorosu.netnet200020171
breezedemar.netnet110020174
faikbezek.netnet90020170
fayeta.netnet60020171
hybline.netnet70020171
parfumzen.netnet90020170
proyapim.netnet80020170
seydikemerata.netnet130020171
yuregircicekci.netnet1411320170
sporcutakip.comcom110320180
bagkurtc.netnet803820121
tufansahin.netnet100020181
pasalartermal.netnet130020181
somailkyardim.comcom130020130
ulasabilirsin.comcom130120150
umranaria.comcom90720110
vtsmobil.comcom82920130
wiselybusiness.comcom140820150
zaferdemirdograma.comcom1702520120
kayagazi.netnet80720121
teksinbank.netnet100020141
akasyaturizm.orgorg120020181
anadoluyed.orgorg100020180
canikbilisim.orgorg120020180
facebookajans.orgorg130020181
forumbilir.orgorg100020181
izmirmezaryapimi.orgorg1602920182
locafilmizle.orgorg120020180
ulaskoroglu.orgorg110020180
worlddroneleague.orgorg160020181
avastreetstyle.orgorg140020180
dusmedernegi.orgorg120020180
duvarresimcisi.orgorg140020181
ecemkurumsal.orgorg120020180
ecialisturkiye.orgorg1401320180
fifiturkey.orgorg100020181
firsatmuzayede.orgorg140020182
hrfunfest.orgorg90020181
merkez-kayit.orgorg120020180
muammerpolat.orgorg120020180
servis-acill.orgorg120520180
slavdernek.orgorg100420180
trbolumfragman.orgorg14191020180
acikkonkur.comcom100020180
acildavetiyem.comcom130020180
adelyagroup.comcom110020180
ahsenbihter.comcom110020180
akmerkezselcuklu.comcom160020180
akucuyagci.comcom100020180
alatomedya.comcom100020180
alaturkaanadolu.comcom150020180
albayrakgyd.comcom110020180
altairyat.comcom90020180
ambertemizlik.comcom1301220180
ankaradabakicihizmeti.comcom210020180
apktcim.comcom70020180
arsdilkoclugu.comcom130820180
arti24destek.comcom120420180
avukatbilgehansayin.comcom190020180
aykomkombi.comcom10401320180
baranspot.comcom90020180
bayanyamacparasutu.comcom180020181
bebegiminilkdogumgunu.comcom210020180
bekci-kontrol-sistemi.comcom210020180
bekci-tur-kontrol-sistemi.comcom250020180
bekci-tur-sistemleri.comcom200020180
bilgehansayin.comcom130020180
birdanesahin.comcom120720180
bodrumevarsa.comcom120020180
bossepetim.comcom100020180
bulenttanir.comcom11397320180
burcinbaykal.comcom127581020180
burumdurum.comcom100020180
bus-turkey.comcom100020180
catibodesign.comcom120020180
cekmekoytaskoprukebap.comcom213520180
comenzarvip.comcom110020180
coolpeoplecoffe.comcom150020180
danakarkas.comcom100020180
demirsosyalmedya.comcom160220181
dogalsiyez.comcom100020180
dogrusuhudapar.comcom140220180
doldurposetini.comcom140020180
ecuzdaniniz.comcom110020180
eforkompresor.comcom130020180
egedentat.comcom90020180
evarimo.comcom70020180
farmasihome.comcom110020180
faydayoga.comcom90020180
fethiyeotoelektrik.comcom180520181
filimsarayi.comcom112520180
fionafotografcilik.comcom180020180
fizyokuka.comcom90020180
florahaliyikamam.comcom160020180
gaziantepotokurtarmajet.comcom230020180
girayonline.comcom110020180
gtradingcommunity.comcom170020180
gundasziraat.comcom120020180
herneysebaba.comcom120020180
hobbyahsap.comcom100020180
icrywallet.comcom100020180
igfmedya.comcom80020180
imaraffibasvurusu.comcom170120181
imaraffidanismanligi.comcom2001220180
imaraffidanismanlik.comcom190220181
imaraffikanunu.comcom140020180
imariskanaffi.comcom130020180
imariskanruhsat.comcom150020180
insanveozgurlukpartisi.comcom220020180
insirol.comcom70020180
internettenreklamver.comcom200920180
inversionmusiclab.comcom170020180
istanbulimarbarisi.comcom180420182
istanbulpaneltelcit.comcom190020180
itibarpuani.comcom110020180
iz-mas.comcom60120180
izmiryildizitv.comcom140520180
izmiryildiztv.comcom130020180
kadikoydogalgaz.comcom150020180
kadikoyusta.comcom110020180
karmod-europe.comcom130020180
karmod-germany.comcom140020180
kasiyez.comcom70020180
kayseribeyintamiri.comcom180220180
kgmakustik.comcom100020180
kilic-cati.comcom100020180
koskapivizesi.comcom130020180
kuruyemistedarik.comcom160020180
kutahyasecim2018.comcom160320180
lezizpazar.comcom100020180
makaledar.comcom90020180
maslakairbag.comcom120020180
mersinclassgayrimenkul.comcom220020180
mesudeates.comcom100020180
microteksaglik.comcom140020180
midillikapivizesi.comcom170020180
mkarastirma.comcom110320180
mutlucleaning.comcom130020180
mvscyr.comcom60720180
ntedavi.comcom70020180
olbiaotel.comcom90120180
omerfarukozgul.comcom140020180
online-marka.comcom120020180
onlinekapivizesi.comcom160020180
osmanligayrimenkulinsaat.comcom240020180
otobusfotolari.comcom1417220180
ozgurhanside.comcom120020180
ozgursivilittifakhareketi.comcom250020180
parsdus.comcom70020180
pasalartermalsuit.comcom170020180
patagonyacumhuriyeti.comcom200020180
pilotentrepreneurship.comcom210020180
pilotgirisim.comcom120020180
polatsrc.comcom80020180
rasimefedakar.comcom130020180
risus190.comcom80020180
roketio.comcom70020180
sakizkapivizesi.comcom150020180
samoskapivizesi.comcom150020180
saricaoglupansiyon.comcom180020180
sedacelikatac.comcom1361220180
selcukmucevherat.comcom160320180
senemtemizlik.comcom130020180
senolkahveci.comcom120020180
sevayatirim.comcom110020180
sivilittifak.comcom120520181
stillprefabrik.comcom141520181
surbahantur.comcom110020180
tarakliaqua.comcom110020180
taraklimacerapark.comcom170020180
tempoarastirma.comcom140020180
tempoarge.comcom90020180
trademillionaires.comcom171020180
tugbayegin.comcom100020180
tutarsanal.comcom100020180
universaloem.comcom120020180
unyetasarim.comcom110020180
upbeatsocks.comcom110020180
vefaliaslan.comcom110020180
venfamobilya.comcom120020180
waffleasmatavan.comcom1528020180
wounbet.comcom70020180
yeniimaraffi.comcom120920180
yetgarage.comcom90020180
zeytinlerim.comcom110020180
zulfukararapoglu.comcom160020180
arazozotomotiv.netnet140020181
burumdurum.netnet100020180
dogrusuhudapar.netnet140020180
doktorlarlistesi.netnet160020180
duruklima.netnet92020181
duzcefindik.netnet110020181
eforkompresor.netnet130020180
fulltimeholiday.netnet150020181
guneykampuskoleji.netnet170020181
imariskan.netnet90020180
imariskanaffi.netnet130020180
imariskanruhsat.netnet150020180
insanveozgurlukpartisi.netnet220020180
karmod-europe.netnet130020180
lezizmutfak.netnet1110020182
omerfarukozgul.netnet140020180
sevayatirim.netnet110020180
taraklimacerapark.netnet170020180
trademillionaires.netnet170020180
yeniimaraffi.netnet120020180
bayanyamacparasutu.netnet180020181
erzincantemizlik.netnet160020181
evdebakicihizmeti.netnet170020180
girayonline.netnet110020180
goksuevdenevenakliyat.netnet210020182
karocu.netnet60020181
ozgursivilittifakhareketi.netnet250020180
sivilittifak.netnet120020181
yusufciftci.netnet110020181
kiraliksite.comcom1101720170
ozdeminsaat.comcom1101120180
sitekiralama.comcom1202420170
kaseffect.comcom90920180
baybul.netnet6609820121
psikolojisozluk.comcom150520180
biotomobil.comcom100020180
yazareser.comcom90020180
faltastik.comcom90020180
kiralikinternetsitesi.comcom2126320170
dersnet.netnet702220171
allinonepost.comcom1257120180
kozmix.netnet60520186
ilkerburak.comcom100420180
dnsbgroup.comcom90320180
erkeksacmodeli.comcom14835820170
rfidsayim.comcom90420170
mangapandas.comcom111320180
azeriradyosu.comcom120020180
ankarazebraperdeyikama.comcom220220180
projeavcisi.comcom110420180
saliherturk.comcom110220180
yaylasehirforum.comcom150020180
doguspompa.comcom1002220170
hikmetburan.comcom110020180
lemanya.comcom70020181
medicalartnisantasi.comcom190120150
beylerbeyisimitcisi.comcom1903120160
kocepoksi.comcom90120160
biduysan.comcom80920180
wpsoru.comcom61479520180
pikksel.comcom70220180
ekentr.comcom62120180
devasainsaat.comcom120620170
firstclasstesisyonetimi.comcom230020170
fullmoonhavuz.comcom1311220170
hazirkiraliksite.comcom160020170
hazirsitekiralama.comcom170020170
internetsitekiralama.comcom2026020170
internetsitesikiralama.comcom2226320170
kasiflerdogada.comcom1401620170
kiralikhazirsite.comcom160020170
kiralikinternetsite.comcom1926320170
mehmetucler.comcom1160820170
peramuzayedecilik.comcom170020170
sayimrfid.comcom90020170
simgediafon.comcom110620170
firstclassbinayonetimi.netnet220020171
amokas.netnet60620141
asoglufasonkesim.comcom161020180
bahcelievlerdesutesisatcisi.comcom270020180
bahcelievlerkombitamircisi.comcom260020180
buzsavacilari.comcom130020180
cerenduran.comcom100020180
emineteyzemutfak.comcom160420180
firatgurgur.comcom110020180
gurbuzpsikoteknik.comcom170120180
hayrinahelva.comcom120020180
itp15010738.comcom110020180
losevdukkan.comcom110120181
nevinguvendik.comcom130120180
okssonline.comcom100120180
ruhbiliminedair.comcom150020180
sivasdugunklibi.comcom152020180
sovranpeyzaj.comcom120220180
sulesencerakbil.comcom150020180
taciriniz.comcom90020180
tasarimcantalar.comcom150020180
vizyonparkmobilya.comcom170020180
yagliboyafotograf.comcom170020180
yusufarici.comcom100020180
kaseffect.netnet90020180
vizyonparkmobilya.netnet170020180
kahramanmarasilan.comcom17369020160
tekfirma.comcom84679320180
inoxmutfak.comcom100720170
erdalisik.comcom99684020070
camidunyasi.comcom110420150
baskiyolla.comcom1001820140
gecemax.comcom702920180
garantisms.netnet1001220091
balikyagi.netnet90720064
bebebox.netnet704201813
allpackagingmachines.comcom2021020180
tahmin102.comcom9479820130
alanya-tour.comcom1101120182
mod-tek.comcom702220180
turkiyemobil.comcom124010420180
fiorecafe.comcom901120180
vehiclesspareparts.comcom181020180
biostudy.netnet8169910520173
allwaterheaters.comcom1511520180
osmanlim2.comcom9171220181
poloangel.comcom90420180
osmanlitatlilari.comcom1601420180
prefabmodularbuildings.comcom223720181
kolayenglish.comcom120020180
amasyahali.comcom100020180
yasaryerlikaya.comcom140020180
siyasifikir.comcom1103620180
formplastik.comcom1101620182
erotikdukkani.comcom1303320181
kresharitasi.comcom120820180
caglayanavukat.comcom140320141
memekanserionline.comcom170920130
kandiradasatilikarazi.comcom2101820140
avcilaravukat.comcom130320140
mainpressjuicery.comcom160620170
heavydutyhydrauliccylinder.comcom264120180
timsahbey.comcom901420180
bilenblog.comcom911520180
iscihakki.comcom941220180
izmirguvenlikkamera.comcom1902020170
buhesap.comcom75901920180
timepieceswatches.comcom1701220180
bigesbarbeque.comcom1341920180
meet2media.comcom1072920180
meet2media.netnet100020180
muhasebekocu.comcom120220180
regalci.comcom701220140
sahilkoruma.comcom110020160
settanitim.comcom1001320140
girginlerinsaat.comcom150020180
altintohum.comcom100020180
cicekutu.comcom80120180
akpartisosyalmedya.comcom1833220160
minikelma.comcom90020180
sizebicakmaklazim.comcom1701020180
mutlulugunkaresi.comcom160220181
abdullahkazdal.comcom140020180
basaranhasar.comcom122020180
karmahayat.comcom100820181
yapiustasi.comcom1011120180
serkanbaratan.comcom1311920180
megadolum.comcom91320180
istanbultiyatrofestivali.comcom240020180
kazbim.comcom60120172
ummetbirligi.comcom120020180
gauhar.netnet642520138
plastiksandalyeleri.comcom190720140
cagal.netnet57220182
alyansvetektas.comcom1401220170
aloeveraisortagim.comcom170520170
atasehiravukat.comcom140020140
basbakalim.comcom100020180
birfikiryazilim.comcom1501720130
botochocolate.comcom130020140
cafetimsah.comcom100020180
cankayaavukat.comcom130020140
drkamerozer.comcom1101820180
eksahayvancilik.comcom1521820140
fcengiz.comcom70720180
hasnakliye.comcom100120140
ottomandesserts.comcom150020180
hemeno.comcom618620171
konakavukat.comcom110020140
megacopyplus.comcom120020140
modernantikalar.comcom150220180
mszkuafor.comcom90320140
nisantasiajans.comcom1403020131
okulplastikleri.comcom150220140
otomatiksera.comcom120020170
parcacini.comcom92720170
varlikofis.comcom100620160
senyuzhaninsaat.comcom1562320140
dogabaski.comcom90020180
atonenerji.netnet100420171
deringrup.comcom914820170
tablobudur.netnet100020171
ayilarvebogalar.comcom150020180
askikadraj.comcom100120180
karabukpsikolog.comcom151120180
bilreklam.netnet90020183
humanmedications.comcom160120180
baskiyolla.netnet100020140
mrbaski.comcom70020180
moveell.comcom70020180
hatirat.netnet70720171
davetotomotiv.comcom130020171
lokmanyildirim.comcom140020180
furnituresandaccessories.comcom243120180
sevdamizinpesindeyiz.comcom200120170
5mmaden.comcom70120170
afk-r.comcom501620170
allforcookie.comcom120020170
alyanspinari.comcom123620170
annemizedanisalim.comcom170220170
avafarma.comcom80220170
berkerelektromekanik.comcom200020170
binbmice.comcom80020170
cemretoptan.comcom110120170
cerkezkoyhal.comcom12942220170
cesmealacatiairport.comcom190020170
cicosgiyim.comcom1001720170
codedesingacademy.comcom1701120170
coffeeterrarium.comcom150020170
davet-otomotiv.comcom140020170
dininikahkiy.comcom120020170
doctorbinternational.comcom200020170
duzgunorganics.comcom140220170
feijianigne.comcom110420170
fitfoodrun.comcom100020170
hesasilver.comcom100020170
horozus.comcom70020170
ipaplastik.comcom100220170
josephinedinlenmekoltugu.comcom240320170
kaysisekeri.comcom110020170
kaysitatlisi.comcom120020170
kiralisi.comcom80220170
kristal-turizm.comcom140020170
lcwaikiki360.comcom120120170
marebungalow.comcom1223120170
mutlukolej.comcom100120170
nsofset.comcom70220170
ornilbutik.comcom100020170
ornilinsaat.comcom110020170
performansburda.comcom150020170
reportwan.comcom911720170
seyyahhyundai.comcom130020170
sitokcu.comcom70120170
tesetturportali.comcom150020170
tunabozkurt.comcom110120170
akdenizbirlik.netnet130020171
cevataydin.netnet100020172
habipkocak.netnet101020170
kristalturizm.netnet130020171
makine365.netnet90020171
mipacko.netnet70020172
proactivegrup.comcom13109720130
sariyeravukat.comcom130020140
smssikayet.comcom100020150
tuiglobal.comcom901320140
uskudaravukat.comcom130020140
zahidovayurt.comcom120020140
irfacigkofte.netnet120020143
212bosphorus.comcom120020180
adanatoptangiyim.comcom160020180
agrodripirrigationsystems.comcom251020180
agromachinesharvesters.comcom221020180
agropulverizatoratomizer.comcom240020180
aircompressorsfilters.comcom210020180
aircraftcomponentsparts.comcom234020180
allautobrakespares.comcom181020180
allbabyhygieneproducts.comcom221020180
allbathkitchenfurniture.comcom236020180
allflourmillingmachines.comcom230020180
allfurnitureaccessories.comcom234020180
allindustrialcooling.comcom200020180
allpackagingbagsfilms.comcom211020180
allsupermarketproducts.comcom224020180
alltraditionaldelights.comcom221020180
aluminiumautospares.comcom190020180
aluminiumzamakparts.comcom193020180
aluminumbalustradeshandrails.comcom282020180
amasisspormerkezi.comcom170020180
architecturaldesigntr.comcom2115020180
armoredsecurityglass.comcom202020180
atasehirceptamir.comcom160020180
autobumperssealsspoilers.comcom240020180
autolightingequipments.comcom221020180
automotivegeneralsupply.comcom230020180
autosteeringsystemsparts.comcom241020180
ayzaet.comcom60020180
babyclothingsshoes.comcom180020180
bakedpastryproducts.comcom190020180
bathcabinetsfittings.comcom202020180
bedscurtainsfabrics.comcom190020180
bigesbarbeku.comcom120020180
bilalemre.comcom90020180
biricdizayn.comcom111020180
bleachedsmiles.comcom140020180
blenderbladesdiscknives.comcom230020180
boyamakinam.comcom110020180
brakecalipersrepairkits.comcom233020180
buildingcontractings.comcom200020180
buildinghoneycombpanels.comcom230220180
bunkbedschairstables.comcom200020180
cannedfoodsjams.comcom150020180
canunsalkirat.comcom130020180
chairmanufacturertr.comcom191020180
chemicalslaboratorydevices.comcom260020180
chilledrefrigeratedshowcase.comcom271020180
cleaningsanitarygeneral.comcom230020180
clothingbabytextile.comcom190020180
commercialfurniturestr.comcom221020180
commercialfurnituretr.comcom210020180
completedripirrigationsystem.comcom284020180
constructionservicesmaterials.comcom290020180
consultancyeducationturkey.comcom261020180
contractingbuildingservices.comcom272020180
cookwarecutlerysets.comcom192020180
cosmeticsdetergents.comcom190020180
cosmeticsperfumessoaps.comcom221020180
csfconsept.comcom100020180
customizedfurnituremanufacturing.comcom320020180
digitech-uz.comcom110020180
displayadvertisingproducts.comcom261020180
driednutsfruitsspices.comcom211020180
dtalperozer.comcom110020180
efespatchwork.comcom130020180
electricelectronicsupply.comcom240020180
elektrostatikboyam.comcom180020180
elevatorcabinsbuttons.comcom211020180
ellibol.comcom70020180
elliboldogalgaz.comcom150020180
ellibolinsaat.comcom130020180
elliboltesisat.comcom140020180
ellibolyapimalzemeleri.comcom220020180
emakbuzum.comcom90020180
engineoilsindustriallubricants.comcom301020180
epdmmoldstpvmolds.comcom170020180
essentialhomemetalutensils.comcom260220180
essienvacum.comcom110020180
europeantrucksspare.comcom193020180
eurotrucksspareparts.comcom201020180
exportvegetablesfruits.comcom220020180
eyluldugunu.comcom110520180
falyelpazesi.comcom1241020180
farmasikayitislemi.comcom180020180
fashionwomensdressclothing.comcom261020180
fifthwheelscomponents.comcom211020180
fitndshape.comcom100020180
flowmetersensorindicator.comcom242020180
foilcuttinglaminationmachine.comcom280020180
foodagriculturesupply.comcom211020180
foodindustrygeneralfood.comcom230020180
foreigntradeservicetr.comcom210020180
fruitsvegetablesseafoods.comcom240020180
fulllaboratoryequipments.comcom241020180
furniturespalletscrates.comcom231020180
furniturewoodproducts.comcom210020180
furniturewoodworkingmachine.comcom271120180
generalfoodstuffexport.comcom220020180
generalmachineexporter.comcom220020180
globallyavailable.comcom170020180
globallyvalid.comcom130020180
goldenbeigemarbletravertine.comcom271020180
gozdehavuzekipmanlari.comcom210020180
hataypryorganik.comcom150020180
homefurniturefullrange.comcom221020180
hometextilesdecoritems.comcom220020180
husbandrylivestockgeneral.comcom250020180
hvacplasticmachinery.comcom202020180
hydraulicsystemspumps.comcom211020180
industrialfurnacesequipments.comcom280020180
industrialpumpsvalvestr.comcom230020180
injectionmachinerymoulds.comcom240020180
investmentsupportservices.comcom250020180
isgorenkiralama.comcom150020180
istanbultiyatrogunleri.comcom220020180
kanosepeti.comcom100020180
kayakdenizi.comcom110020180
kitchenbathroomfurnitures.comcom254020180
kitchenwarecookwaretr.comcom210020180
kitchenwareglasswaretr.comcom220020180
kugupsikoloji.comcom130020180
landlordburger.comcom140020180
landordconstruction.comcom190020180
landordproperty.comcom150020180
leventloftkiralik.comcom170020180
lineautomationconveyingsystem.comcom290020180
lowbedtrailerstippers.comcom210020180
lubricantslpgkits.comcom170020180
machinery-veterinary-textile.comcom280020180
maidanankarakiralik.comcom190020180
maidankiralik.comcom130020180
marbleminingbuilding.comcom200020180
medicaltestkitssupplies.comcom230020180
medicinesmedicalproducts.comcom240020180
menesretail.comcom110020180
menswomenskidsclothing.comcom222020180
mentesebetonelemanlari.comcom220020180
mersinkutuharfmerkezi.comcom210020180
metalsironsteel.comcom151020180
methidemirbasinsaat.comcom190020180
misbaski.comcom80020180
noktarobot.comcom100020180
notjustcodes.comcom120620180
numankorkmaz.comcom120020180
officechairsarmchairs.comcom211020180
optikoon.comcom80020180
organicricebrass.comcom160020180
oslonicera.comcom100020180
outlet-urunleri.comcom150120180
oyaztekstil.comcom110020180
packagingmachinesmaterials.comcom261020180
packagingplasticmarble.comcom220020180
paintscoatingstoners.comcom200020180
partstruckaccessories.comcom210020180
pearlsmilenow.comcom130020180
pearlsmileone.comcom130020180
pearlsmilepro.comcom130020180
pearlsmilezahnafhellung.comcom230020180
pedagogserife.comcom130020180
pergolauprightawning.comcom200020180
personalcleasinggoods.comcom210020180
perukdiyari.comcom111020180
pharmaceuticalsdrugspills.comcom250020180
plasticpackagingitems.comcom210020180
ponciksus.comcom90020180
powderpaintingcoating.comcom213020180
prefabricatedmassbuildings.comcom261020180
privatelabelclothingtr.comcom223020180
pryorganik.comcom100020180
psikologbusrauzuner.comcom190020180
psucheconsultancy.comcom170020180
radyofabrikasi.comcom140020180
railsystemsequipments.comcom210020180
rasyonelcanta.comcom130020180
refrigeratedvehiclestr.comcom221020180
restaurantcafefurnitures.comcom2466020180
roomfragrancediffuser.comcom210020180
sackclothingmachine.comcom190020180
sahindus.comcom80020180
samsuntadilatustasi.comcom190020180
sandingpolishingmachines.comcom240020180
securtiyballisticsolutions.comcom261020180
sefikinsaatsimas.comcom160020180
serenitaverde.comcom130020180
sesametahinispices.comcom181020180
shotgunshuntingguns.comcom191020180
sicakmama.comcom90020180
sisteminoksdekorasyon.comcom210020180
sizebircakmaklazim.comcom180020180
skylandkiraliksatilik.comcom210020180
slewingringsbearings.comcom200020180
smartautomationsystemstr.comcom240020180
smiledentalnow.comcom140020180
sofaseatsarmchairs.comcom181020180
softwaresolutionsforall.comcom230020180
sparepartstruckstrailers.comcom240020180
specialaimvehicles.comcom181020180
sprinklerdripirrigationsystems.comcom300020180
stardenteurope.comcom140020180
steelaluminumcastings.comcom212020180
steelspaceframestructure.comcom240020180
stonecollectormanurespreader.comcom280020180
supermarketracksystems.comcom220020180
supplyconstructionmaterials.comcom270020180
supplycosmeticproducts.comcom220020180
supplyfreshagroproducts.comcom232020180
supplyvegetablesfruits.comcom220020180
tankerstrailerstippers.comcom221020180
tekyumoto.comcom90020180
textilebuttonslabels.comcom201020180
tiltingturningsystems.comcom210020180
timberwoodproductstr.comcom200020180
tourismfoodindustry.comcom190020180
tractorstrucksspareparts.comcom241020180
triabeypinar.comcom120020180
tuncaykap.comcom90120180
turkishdelightscandies.comcom222020180
uclerlazer.comcom100020180
ulasair.comcom70020180
uniformsfabrics.comcom151020180
urbanfitnessequipments.comcom221020180
vegetablesfruitsfresh.comcom211020180
vergeturkiye.comcom120020180
vesselsshipsboats.comcom171020180
vinegarssauces.comcom141020180
wastebinpaperdispenser.comcom225020180
waterboosterspumps.comcom180020180
waterinsulationchemicals.comcom241020180
whitesmilesshop.comcom150020180
wholesalesteelmaterials.comcom231020180
windowsdoorpvcprofiles.comcom221020180
wooddoorspvcwindows.comcom190020180
woodendoorscabinets.comcom195020180
yapikayitmerkezi.comcom160020181
yapitespit.comcom100020180
yk-yzshop.comcom90020180
abdullahkazdal.netnet140020180
alperpolat.netnet100020182
baskivar.netnet80020181
erturkglobal.netnet120020181
mobilonkazanc.netnet130020180
sami4budak.netnet100020181
serhattv.netnet81120182
elizzi.netnet60020181
skylandkiralik.netnet140020181
22nisan.comcom70720180
baykentmetal.comcom12143820111
kozmetiksepet.comcom1303720180
nazarorganizasyon.comcom1721620142
otelmarket.netnet10134720094
yatilieleman.netnet121773420081
laboratuvar.orgorg1112020118
sonybayii.comcom931720100
bobrektasinason.comcom1512020160
bankacilik.netnet1086120065
frigorifik.netnet1066820111
teknik-servisim.comcom150820180
oztelelektrik.comcom133020181
ucuzpokerchip.comcom1301020181
izmirsehri.comcom1022720161
hamitbulenteken.comcom1522720180
ozgursecim.comcom101823620110
adtmuhendislik.comcom1422020160
tessanmakina.netnet1233820121
herbalideal.comcom110420180
toptanchip.comcom1001620180
kosarinsaat.netnet110620142
yasampark.orgorg954720113
e-eczane.orgorg80520186
joomlasef.netnet911220101
fiberglasssaksi.comcom150920142
utaxguneydogu.comcom1322820160
afyonunsecimi.comcom1352320130
moreanmore.comcom1001020181
pinarkomurculuk.comcom1521020150
alanyagunlukkiralik.comcom1941720171
ozturhanvinc.comcom1245120100
hdkozmetik.comcom100220170
gercekbulten.comcom120620180
sedyapim.comcom812120110
fiberglassustasi.comcom1601120140
polyesterimalat.netnet1504620140
istanbulsokaklari.comcom17211420092
stoksan.netnet70020182
polyesterustasi.netnet1502720141
moderngranit.comcom12243020180
cafelipto.comcom90020180
dogumfiyati.comcom110020160
dogumfiyatlari.comcom140120160
tutumasaallah.comcom130020180
enyakincilingir.orgorg150620142
imexsol.orgorg70020121
tarzmobilya.orgorg1101220126
berilmobilya.comcom129920180
bodrumhavafotografcilik.comcom233781420140
dogussove.comcom90020180
galerimobilya.comcom1301220130
garantigaraj.comcom120020171
isyerimgaranti.comcom1401320073
kemalbaykal.comcom110020180
koralzeytin.comcom1101520110
megaldi.comcom742620180
mercedes-benz-m360.comcom1801420120
dieltemizlikhizmetleri.comcom220520160
dogumucreti.comcom110020160
goldmaxsoba.comcom1122820160
hetasmetal.comcom100020161
merbeymekanik.comcom130120160
modamakina.comcom100220160
zileornekmakina.comcom150120160
mezemore.comcom80020180
kanalboyu.netnet90820111
tavsiyemarket.comcom130320120
astroloci.comcom90920180
helalkonsept.netnet120020181
htpcrehberi.comcom114920170
bodrummozaikart.comcom150020170
cabinet34.comcom90120170
deksagayrimenkul.comcom160120172
gumusinsaatcorlu.comcom1611220170
huzurmutfagi.comcom120020170
ilkdoor.comcom70020170
kapalialandacalisma.comcom190020170
kapalialandacalismaegitimi.comcom260020170
kapalialanlardacalisma.comcom220020170
ozaliciletisim.comcom140120170
sapancasaat.comcom110020170
talayburo.comcom90120170
woodenparke.comcom110020170
kebabsiparis.netnet120020171
kebabsiparisi.netnet130020171
a2sut.orgorg50020172
sercangurlemez.comcom1401520180
tavsiyepazar.comcom120020120
vahapergut.comcom100620140
yangincikis.comcom110120130
dekormodelleri.netnet140020141
isyerimgaranti.netnet1401120073
quantumbilisim.netnet140020122
zerumax.netnet70920081
adnanuzkara.comcom110020180
ahmetaysu.comcom90020180
ahsaptiffanysandalyeimalati.comcom270020180
ahsaptiffanysandalyekiralama.comcom280020180
ankaraimarbarisi.comcom160020182
aplushydrafacial.comcom168820180
arslongaturkey.comcom140020180
artistanbul360.comcom140020180
ataantik.comcom80020180
atamezat.comcom80020180
balatgalata.comcom110020180
brawwa.comcom60020181
btcbvifinance.comcom130020180
canakkalebasartel.comcom171020180
cemkaderoglu.comcom120020180
cepteseo.comcom80020180
cevdetart.comcom90020180
deesmimarlik.comcom120020180
dimeorganizasyon.comcom162020180
ekerceyhanavukatlik.comcom190020180
ezzadolabim.comcom111020180
hatsanatistanbul.comcom160020180
helalkonsep.comcom110020180
imar-barisi.comcom110020183
istanbulbalat.comcom130020180
joyinntravel.comcom120020180
kafoutdoor.comcom100020180
kagitkapla.comcom100020180
kaimecoin.comcom90020180
karatay70noluasm.comcom160020180
kiraliksandalyeistanbul.comcom230020180
mordogancinarinsaat.comcom190020180
originalservicepack.comcom190020180
orjinalservisekran.comcom180020180
ozbaelektronik.comcom140020180
pinaraktel.comcom10181220180
sahibindenatasehirofiskiralama.comcom300020180
sefkatogluyapi.comcom140020180
serapzincir.comcom110020180
serbestdolasan.comcom140020180
signorcigar.comcom110020180
tantaoglugayrimenkul.comcom200020181
toplayiciyapi.comcom130520180
vikingmedyagrup.comcom150020180
yuzmeekipmanlari.comcom160020180
armancons.netnet90020180
helalkonsep.netnet110020180
signorcigar.netnet110020180
eczamplus.orgorg90920180
helalkonsep.orgorg110020180
helalkonsept.orgorg120020181
stoksan.orgorg70020182
zorbozanyapi.comcom12132020150
teknikeller.comcom1153241020153
kiamp.comcom50820070
313th.comcom5143620162
m6e.netnet31120139
pes2013.comcom7121410120110
nurazar.comcom70020180
balevi.netnet601120185
labtechmed.comcom10565120130
samanlife.netnet921620182
tufanmt2.comcom831320180
padisahcigkofte.comcom15206820100
highwayprint.comcom120220171
atolyeyolculuk.comcom140320180
pimamt2.comcom76020180
doktorhekimonlugu.comcom1701620120
defneapart.netnet1032620141
hdphotographydesign.comcom191720180
ilerimarket.comcom110520170
nikandent.comcom90420180
altistr.comcom702120180
ansevent.comcom80120170
aysemelikecerci.comcom150020180
bazaremobil.comcom110620150
elkavira.comcom801720152
hatunik.comcom71720180
kayserimakasliplatform.comcom220120180
konteynirlashing.comcom160420110
konteynirsabitleme.comcom180220110
labtekmedeurasia.comcom160120130
labtekmedfuari.comcom140120130
m2-blast.comcom81120180
malatyasiteyonetim.comcom180220180
mirasmakina.comcom110820150
yag-san.comcom70820161
leadervps.comcom911420161
ahmakbilge.comcom100020160
mandakstudio.comcom1231020160
denizliisipompasi.comcom170020160
ilackutusu.netnet100020181
glcyapi.comcom70220180
ostad-shagerd.comcom131120180
takvamt2.comcom80120180
bakimda.netnet70020180
savorgame.netnet9182920171
enevim.comcom60120170
irannillkin.comcom1101720170
samiraesmaeili.comcom140120170
mohtavaa.comcom80020171
parsanil.comcom8102520170
mbdagency.netnet90020172
arkarikan.comcom90120170
gocukpark.comcom90220170
highwayprinting.comcom150020170
irangame24.comcom101320171
turkuazahsapkutu.netnet160020170
sevkiyatsandiklari.comcom1801220110
tirlashing.comcom100420110
visnelikadin.comcom1202420120
bakimda.comcom70020180
ocemut.comcom60020180
parkebayii.comcom100020180
solfej56.comcom80020180
tariflertatlar.comcom140020180
vilaluxury.comcom101020180
alexiamt2.comcom90020180
amirpal3.comcom81020180
amirpal8.comcom80020180
amirpay3.comcom80020180
amirpay8.comcom80020180
guysmt2.comcom76020180
hardcaseturkey.comcom140020180
joemmt2.comcom70020180
mehsen2.comcom725520180
mugimt2.comcom70020180
sakhtmarkets.comcom120020180
baranalpaslandogan.comcom180020180
egepromosyonurunleri.comcom200020180
esfizyoterapi.comcom132020180
gemkayahukuk.comcom120020180
kyanitmt2.comcom90120180
adiyamantaksileri.comcom171020180
alovisairan.comcom110020180
atlaskampus.comcom110020180
babalametin2.comcom126320180
beyazsiteyonetim.comcom160020180
canyoning-parseh.comcom160020180
elvinmt2.comcom8131020180
komatsoebadi.comcom120020180
mefaplasik.comcom100020180
ictdkish.netnet80020180
ballbaz.comcom70020180
designytee.comcom100020180
m2-nida.comcom70420180
royem2.comcom60020180
yenilerrr.comcom90020180
ispartaperde.netnet120020181
seriilantv.comcom1002220070
epmimarlik.comcom1021820050
akarelektronik.netnet1401020111
akarelektronik.comcom1402520111
gamgmbh.orgorg702020110
bedava-enerji.comcom1301220080
elektrikbedava.comcom1401220080
enerjibedava.comcom1201220080
flughafentransferturkei.comcom230920130
otsbagaj.comcom80820110
otsotobagaj.comcom110620110
genoksreport.comcom120120170
iskenderunvizyonpark.comcom200120170
mimarltd.comcom80220170
transfertaeroportantalya.comcom240020131
transfertaeroportturquie.comcom240020130
transferturkei.comcom140020131
zephyrcyprus.comcom120120080
pinkpointdavetiye.comcom170020180
agriexport.comcom10106186199914
burtonparma.comcom1167420180
gizligercek.comcom1116820180
insaatvizyon.comcom12427920180
ondertesisat.comcom1201920180
ozankocak.comcom993020180
socialmediapark.comcom15864920180
manypolo.comcom862620180
abracadebras.comcom1234920180
profilstar.comcom104743220181
esmatunc.comcom864520070
genepriest.comcom1002420130
utopyasanat.comcom111042920180
bellsagraf.comcom1044020040
sahakuma.comcom81097320060
zafercable.comcom1021720080
stilmerdiven.comcom1223020070
formtimecenter.comcom1441020180
mesterica.comcom921220181
terazidere.comcom1001120120
turkanahtar.comcom11636520180
gonuldekorasyon.comcom1551720170
coffeysalon.comcom1143520180
miracleforest.comcom1362520140
ustahome.comcom802220180
pureannarbor.comcom120620170
kayseripatent.comcom1315820172
bowlingpass.comcom110420170
pizzacosmos.comcom1105020181
moritzmini.comcom1017715620160
martinazink.comcom1101820090
isabelamaya.comcom1132420171
tokasafety.comcom10497820030
fotorodrigues.comcom13142120182
trafikegitim.comcom1204120140
ozonankara.comcom1002820181
stocksolo.comcom9141020180
phenixmetal.comcom1103620080
pikepace.comcom80820180
duyumsuz.comcom8275720180
harbortalk.comcom1001320130
kardelenbanyo.comcom1305120180
manisamarka.comcom1101720180
laramark.comcom806020140
erikburlingame.comcom1412420050
marthasalas.comcom1101520040
muglapozitif.comcom12360716220180
anketanaliz.comcom11101120180
romandoctor.comcom11566820052
baripastapizza.comcom14302620180
antalyameeting.comcom1492820160
jinekologdoktor.netnet153918520181
sokun.netnet5255420187
lompocmail.netnet1001120070
kozmos.netnet62101201627
phenixmetal.netnet110620080
mavitavsan.comcom10112520180
afgan.netnet5035201816
minibaja.orgorg814720183
kutuk.orgorg5012201811
gazeteseriilan.orgorg1446320082
balikyagi.orgorg903420064
kitaharima.orgorg1001520053
gomme.orgorg5024200025
toursurat.comcom923220150
albertaculture.comcom1401720170
iranmanganese.comcom130320160
imgematbaa.comcom108141820181
martinbernard.netnet13392020159
tabakking.comcom90720151
villahara.comcom946420171
kazancyolu.comcom1001920130
okcugrup.comcom82620140
dizimakinesi.comcom12233620180
purecrystal.orgorg110120187
delideli.netnet8227201722
bikinitees.comcom1001320070
golfcrossing.comcom1201920070
aksuoptik.comcom901120180
tanesalem.comcom903020151
windsorpark.orgorg11377201510
doganugur.comcom9211320171
successideal.comcom1246120180
seslikars.comcom962020180
ankaraharita.comcom12164710420180
tsunamimodel.comcom1201820171
antoniolocascio.comcom1512120171
melekforum.comcom10765320140
karobardainik.comcom1301120180
malakmedia.comcom1001820150
securityplanet.orgorg14034200911
bozma.netnet545520184
kuklahane.comcom90320180
coloringposter.comcom1401320150
akdenizbirlik.orgorg130220171
miniball.netnet81313420188
takagemi.comcom831720180
dostfilm.netnet80720183
duckaday.comcom801520180
kokubota.comcom851520061
saraykozmetik.netnet130720161
tunnelbana.netnet10165520175
mamalunas.comcom9202320180
deminsion.comcom948920180
metalender.comcom100820161
oakleymarket.comcom12721820180
stereomartini.comcom1347820070
arenagaming.orgorg117934201311
sukran.netnet603820085
spermhole.comcom932620170
ayakkabiaski.comcom1222720180
ucuzhaliyikama.comcom1401020121
adampaul.orgorg801720152
testitest.comcom90720170
irfankara.comcom91220100
emindekorasyon.comcom1401520180
latastudio.comcom100120170
bakupark.comcom801220180
garantisikayet.comcom140720170
almastevenson.comcom130320170
pusatbaca.comcom901320160
hunterbats.comcom1001320080
jurnalkita.netnet10224920181
williamsonmotor.comcom1502620180
baglik.comcom601520100
araskembang.comcom110020180
duzcedekorasyon.comcom1503220170
paulbana.comcom80520150
fatihkaba.comcom951020170
hutur.comcom54671720171
vatanstar.comcom912920180
agramarket.comcom1003020182
princesalah.comcom110120180
ranthill.comcom80120180
binapark.comcom812920180
hakanyesilkaya.comcom1401420130
everettstore.comcom120820150
safetymama.comcom100720180
boiseparalegal.comcom1401620141
virgulreklam.comcom1242520130
panoramadrama.comcom1301820152
staroakgrove.orgorg1201420170
nicelovely.comcom10193020140
hizlisiparis.orgorg124923620176
agorarondonia.comcom1301920170
alfakurs.comcom81620182
tangotonsberg.orgorg1342720131
safariwood.comcom1001820170
ozarkbeer.comcom901420180
umurdagli.comcom911320160
malaysiamail.netnet122820181
meraklipenguen.comcom14123920140
rwandafilm.orgorg1093645220131
senaturk.comcom822720141
ogulturkpetrol.comcom1441520100
markamanisa.comcom111320180
ozgesimsek.comcom100120160
kulakpili.comcom94320180
savagegrip.comcom100020180
adresnatura.comcom110720170
karacuba.comcom801320180
takasafi.comcom8114120180
camihalicilik.comcom130020180
ipekbutik.comcom901120180
clarionpartner.comcom140020180
depoozon.comcom80420160
kozadent.comcom801420180
elispire.comcom811220140
tasitmarket.comcom118520130
grossegolf.comcom100020140
ciromedina.comcom100320140
namesnook.comcom90020140
mamadeva.comcom8143720181
worthmenlopark.comcom143920130
geneares.orgorg8121620180
elsacampobasso.orgorg14171220140
sadecehayalet.comcom130120180
kupaotomat.comcom100020180
selfmadesite.comcom120520180
petitetalk.comcom100120160
marinemalak.comcom11131920110
motelmalibu.comcom1101420181
stepcenter.orgorg100520185
homekenya.netnet90820151
irisbeta.comcom8241920180
hakikikabakci.comcom1313120180
dumantasarim.comcom12231720180
altayebatmarket.comcom150120150
ninegardens.comcom110820183
kemalyavuz.comcom100220180
franktrout.comcom100020180
florafleet.comcom100120130
coloringvista.comcom130320180
successselftalk.comcom1510920180
japantransfer.comcom130320180
dolapistanbul.comcom130020160
turkarta.comcom8109420121
sadabadi.comcom8123920170
baileymartin.netnet120020183
gruperba.comcom8862020180
parkhillcountry.comcom1511320140
patisaray.comcom921120131
plazamotor.netnet1002020183
muenchenpizza.comcom130220181
panamaphoenix.comcom131520180
pembestil.comcom92520180
kibrisjigolo.comcom1222320160
dachaualbum.comcom110220161
akdenizantrepo.orgorg140720140
arenaverona.orgorg11024201416
illinoisstep.orgorg120320150
northshorebahai.orgorg150220080
polislik.orgorg804920192
testpark.orgorg82511201510
yogasrilanka.orgorg1211020133
aglasun.comcom743320185
ailegelisim.comcom110220152
atkipusat.comcom983520110
bavliindex.comcom100020080
bebetigre.comcom992920150
biciberg.comcom80020070
braceygeneral.comcom130220130
bruneifilm.comcom1001120180
copperstarbison.comcom150120150
derinipek.comcom90120140
dinctasimacilik.comcom153937120180
dogakartal.comcom100320150
dunyapolis.comcom1001220091
erdemprotez.comcom110820101
etlikperde.comcom1002120101
evrenerdem.comcom100920100
formandomas.comcom1102520030
genigene.comcom801220180
gevenambalaj.comcom1201220120
ginabolton.comcom1003220050
gorgulualtin.comcom120220140
hannamoda.comcom90020180
hopesafari.comcom1001120131
howardmarkadams.comcom150220150
huntingtonharp.comcom140120130
hurdabelgeli.comcom120020180
iranzumrut.comcom1032720110
itinamarket.comcom110020120
jiujitsustop.comcom120220110
katiewing.comcom90920140
katkimuhendisi.comcom140520140
katyyogurt.comcom100120140
keciorenperde.comcom1302020101
konakdent.comcom91121120180
kulevincnedir.comcom130720150
lahmacuniste.comcom120220170
lalelale.comcom802120120
lewisengel.comcom100220150
mamamarche.comcom100020150
mayayogadubai.comcom1301120180
metahighway.comcom1101120180
metaldiploma.comcom1201420130
modulkonut.comcom100020140
mongolialink.comcom120220180
muzikgarden.comcom110220070
nagelpunt.comcom90120181
oglevideo.comcom9302920180
onceenergy.comcom1027520150
patriagani.comcom10621220181
pillpanel.comcom90220180
aryabarco.comcom991120160
hebasari.comcom80220160
gammaprince.comcom1191520160
ubudyogastudio.comcom140020160
yarenlegal.comcom100220160
greenbackfire.orgorg130920161
afakturk.comcom83320160
bergamotunion.comcom130120160
coachellalala.comcom130120160
ellicapital.comcom111220160
fezayapimekanik.comcom150320160
kurabiyeyapim.comcom130120160
lockhartbeer.comcom120120160
milokaplan.comcom100220160
southlakecoffee.comcom150120160
dibasafir.comcom971320160
iranmadame.comcom10424420160
dayaniklitabak.orgorg140620160
saripatiserat.comcom130320160
ayakomura.comcom90720160
palacashmere.comcom120020160
incilojistik.netnet120020126
projectlakeside.comcom150320180
tangobologna.comcom120020181
rosellemisir.comcom120020180
saramilano.comcom100420182
hobipasta.comcom90020180
yakadone.comcom80020180
putrajayateknik.comcom152120181
stationrobot.comcom120020180
ebruserdar.comcom100020180
halisahafutbol.netnet1403820101
hammondstar.orgorg1112020182
creditform.orgorg100020185
notapill.netnet82820181
tutulusatis.comcom110820180
simonalin.comcom93520180
fuzeturbo.comcom90520180
alfaqatar.comcom92220180
fareohio.comcom80420180
holidaymeme.comcom110120180
papasana.comcom80320181
totomadam.comcom96471420180
floreparis.comcom105320170
lakapinta.comcom912420170
kazanclibahis.netnet13108320171
arenabuenavista.comcom150120170
motorsantafe.comcom120220170
roeslime.comcom80220170
vegaokul.comcom80120170
agrinoto.comcom81320170
alishabyford.comcom120220170
almahare.comcom81320170
bankanova.comcom90120170
coffeeuniversal.comcom151820170
helallojistik.comcom1303620170
hobicanada.comcom100120171
mavikoruma.comcom100520170
saraconverse.comcom120620170
simitiste.comcom90220170
socialbelarabi.comcom140120170
sporbeta.comcom80120170
surprizanaliz.comcom130120170
tangoromeogolf.comcom140120170
tenceremedia.comcom120120170
tungstenbell.comcom120120170
tungstenbells.comcom130120170
titanamerican.netnet130020171
canliyosun.comcom100220170
doruksafety.comcom110020170
hopeemin.comcom80020170
parksiena.comcom90320170
tabloyosun.comcom100120170
yosunpano.comcom94020170
doruksafety.netnet110020170
edenpoker.orgorg9176820179
persatlantic.orgorg120120170
saricoin.orgorg80120171
vadimobilya.orgorg110120170
alinespera.comcom10772020170
gulechukuk.orgorg100020171
fiberhomemarine.comcom150020170
tarihifikir.comcom110120170
traplacon.comcom90120170
chevalnaturel.comcom130120171
palafoto.comcom80320170
parkspot.orgorg800201716
madamelli.netnet90020141
capronstar.comcom100120170
togosong.comcom821020150
sultanswords.comcom120420180
ulyssesbikes.comcom120120181
senatorlake.comcom1101720180
pizzaflorian.comcom120120140
populerkisi.comcom110520120
sancaktepeparke.comcom1501520130
servireform.comcom110320140
silexstar.comcom90120120
sinistersignal.comcom140220130
solastudiosalon.comcom150920100
stepkingside.comcom120020150
stepkingsite.comcom120020150
tokelaufilm.comcom1101620180
totopolo.comcom80120150
urbanbarrio.comcom110220150
catalhoyuk.netnet1001420004
frankhorton.netnet1101420091
itinamarket.netnet110020120
pedalportland.netnet130920112
safetyvietnam.netnet130020141
samakays.comcom801120180
sanaldepocu.comcom1101020180
betatrinity.comcom110220180
bozkirhukuk.comcom110020180
dulceamandita.comcom130020180
kusebuchen.comcom100020180
martmalta.comcom90020180
nailedep.comcom80020180
silkiwhite.comcom100020180
americanaartist.comcom150020180
bestevertrust.comcom130020180
busesite.comcom80020180
cevapgeldi.comcom104220180
christiankaiden.comcom150020180
dakotareel.comcom100020180
darispay.comcom80720180
depolyme.comcom80020180
efsanemuzayede.comcom140020180
ezgiuysal.comcom90020180
galabanco.comcom90020180
globalwhites.comcom120020180
hirahurma.comcom90020180
iliksummit.comcom100020180
japanerik.comcom90020180
joinersafari.comcom120020180
kapalinikah.comcom110020180
kibrisprinter.comcom130020180
lazydistributor.comcom150020180
lindavalerie.comcom120020180
majormerit.comcom100020180
marketsoprano.comcom130020180
merciking.comcom90320180
meteormuscle.comcom120920180
onderenterprise.comcom150020180
palmbebe.comcom80020180
patentadana.comcom110020181
romamade.comcom80020180
sallanacak.comcom100020180
silverminature.comcom140020180
sterlingfava.comcom120020180
swiftenginering.comcom150020180
tenormadencilik.comcom150020180
tesbihosmanli.comcom130120180
transferunite.comcom130020180
turkmenpeyzaj.comcom130020180
ugandamarch.comcom110020180
uygunmuzayede.comcom130020180
vancouveramazon.comcom150020180
villaspringacre.comcom150020180
voltcoffeestop.comcom140020180
woodsholemaket.comcom140020180
darispay.netnet80120180
artkange.orgorg81020181
chennaidost.orgorg110020181
amoskarma.comcom90020180
aparatcoin.comcom100020180
arifabali.comcom90020180
feministindex.comcom130020180
hanaalay.comcom80020180
harveypala.comcom100020180
lezzetlielma.comcom120020180
lezzetlierik.comcom120020180
lezzetlihurma.comcom130020180
lezzetlikarpuz.comcom140020180
lezzetlikavun.comcom130020180
lezzetlikiraz.comcom130020180
lezzetlikivi.comcom120020180
lindsayplaster.comcom140020181
lovingbikini.comcom120020180
sergilegal.comcom100020181
barronpilot.netnet110020180
kodiakfire.netnet100020182
modernnatural.netnet130720185
christianseeker.orgorg150020181
newportstar.orgorg110020181
socialcibil.orgorg110020181
tamponkarma.orgorg110020180
aburasik.comcom80020180
atlasotomat.comcom110020180
iranchoco.comcom90020180
memeriya.comcom80020180
sunustat.comcom80020180
baiyunmark.comcom100020180
baiyunmart.comcom100020180
springurban.comcom110020180
canisaveenergy.comcom140020181
kantleek.comcom80020180
sendesion.comcom90020180
sucluster.comcom90020180
mailself.netnet80020182
senatoragency.comcom130020180
cabasanantonio.comcom140020180
corumreferans.comcom130020180
otobusbahce.comcom110020180
sorongmarket.comcom120020190
nailkure.comcom80020190
spotreno.orgorg80020191

Dün ve daha önceki günlerde düşen alan adlarını linkte bulabilirsiniz: Dün Düşen Domainler

Uzantı alan adlarını uzantı türüne göre bu bölümde görebilir ve tablo sıralamasını bu sütündan değiştirebilirsiniz. Eğer sadece COM uzantılı adresler ile ilgileniyorsanız aşağıdaki tabloda “Bul” kısmına “.COM” yazmanız halinde sadece bu uzantıya sahip adresleri görebilirsiniz. Sitemizde sadece önde gelen 3 uzantıya yer veriyoruz. Bu kısımda .NET ve .ORG uzantılarını da aynı yöntem ile listeleyebilirsiniz.

Uzunluk bu sütunda alan adlarını karakter sayısına göre küçükten büyüğe yada büyükten küçüğe doğru sıralandırabilirsiniz.

Backlink sayısı alan adının sahip olduğu toplam backlink sayısıdır. Maalesef internette düzgün çalışan API bulmak çok zor olduğu için bu verilerimiz güvenilir değildir. Eğer backlink değeri için alan adı alacaksanız lütfen kendiniz de adresi sorgulayınız. Tablomuzdaki veriler yüzde yüz doğru değildir bu sütunumuzda.

Archive sütununda adresin archive.org sitesinde yer alan kayıt sayısını görebilirsiniz. Domainin daha önce hangi kategorilerde ve aktif olarak yayın yapıp yapmadığına dair bu bölüm fikir vermektedir.

Son Kayıt sütununda adresin bilinen en eski kayıt tarihi yer almaktadır. Domainin geçmişi için önemli bir kriterdir.

Toplam Kayıt sütununda ise com, net, org gibi kaç farklı uzantısının kayıtlı olduğunu görebilirsiniz.


Satılık Alan Adları

Haftanı popüler webmaster forumları ve domain platformlarında devam eden açık arttırmaları ve hemen al fiyatlı satışlarını aşağıdaki listemizde bulabilirsiniz.

Listemiz sürekli güncellenecektir, alan adları ile ilgileniyorsanız lütfen yazımızı hafta boyunca takip edin !

Açık arttırmada olan alan adlarının isimlerine tıklayarak satışın yapıldığı sayfaya gidebilirsiniz.

İlgilendiğiniz Adresler İçin Linteki Bağlantıdan Bize Ulaşabilirsiniz: Domain Satış

DomainKategoriFirmaKayıtBitiş
hiyeroglif.comJenerikNameBright20162020
kofa.netCVCVGodaddy19982020
sosyaluzman.comWebmasterNamebright20182020
sosyalasistan.comWebmasterIonos20192020
aktuelbrosur.comGenelIonos20192020
iletisim.orgGenelGodaddy20012020
ressam.netGenelGodaddy20022020
beyler.netGenelGodaddy20002020
firmalar.orgE-TicaretGodaddy20062020
mp3indir.orgGenelGodaddy20032020
izindeyiz.netJenerikHostingcomtr20192020
arabailanlari.comOtomotivGodaddy19992020
guzelseo.comWebmasterGodaddy20192020
seoscore.netWebmasterGodaddy20172020
adanaliyik.comGenelNamebright20152020
seodukkani.comWebmasterRegisterit20192020
kartalkolik.comGenelRegisterit20192020
astrolojiyorum.comGenelRegisterit20192020
karadenizfirtinasi.comGenelRegisterit20192020
muhi.netCVCVHostingcomtr20192020
pezu.netCVCVNamesilo20192020
guhi.netCVCVHostingcomtr20192020
vohe.netCVCVHostingcomtr20192020
levu.netCVCVHostingcomtr20192020
vuce.netCVCVHostingcomtr20192020
kevu.netCVCVHostingcomtr20192020
luhi.netCVCVHostingcomtr20192020
gihu.netCVCVHostingcomtr20192020
gundem724.comHaberGodaddy20192020
dizih.comDiziRegisterit20182021
mangir.netCoinHostgator20172019
aydinlik.netJenerikRegisterit20032019
kredimo.comEkonomiRegisterit20192020
uzmansec.comE-TicaretGodaddy20192020
belinay.netİsimHostingcomtr20192020
cumhuriyetaltini.orgEkonomiRegisterit20182020
gorselarama.comGenelGodaddy20182019
gorselbilgi.comGenelGodaddy20192020
aranmahacmi.comWebmasterGodaddy20192020
espriler.orgGenelRegisterit20182020
oyunsepetin.comOyunRegisterit20182020
ozgunyazi.comGenelGodaddy20192020
bagcilar.coİlçeGodaddy20192020
gaziosmanpasa.coİlçeGodaddy20192020
bahcelievler.coİlçeGodaddy20192020
sariyer.coİlçeGodaddy20192020
kagithane.coİlçeGodaddy20192020
catalca.coİlçeGodaddy20192020
buyukcekmece.coİlçeGodaddy20192020
zeytinburnu.coİlçeGodaddy20192020
gungoren.coİlçeGodaddy20192020