27 Nisan 2019 Cumartesi düşen domain (alan adı) listelerini yazımızın devamında bulabilirsiniz.

Domainlerin düşeceği gün, en geç saat 17.00-18.00 saat aralığında günün listesi sitemize eklenmektedir.

Facebook’ta Takip Et, Listeler Eklendikçe Haberin Olsun: https://www.facebook.com/isimyakala/


27 Nisan Bugün Düşecek Alan Adları

Aşağıda kategorilere göre ayrılmış alan adlarının bir kısmını görebilirsiniz. Bugün sizler için seçtiğimiz alan adının tam listesini yazımızın alt bölümlerindeki tablomuzda görebilirsiniz.

Jenerik domain önerileri;

Jenerik alan adları bölümünde TDK Sözlük anlamlı düşecek alan adları listelenmektedir.

acemi.cc
arap.org
baht.cc
baldiz.net
cakim.cc
cehennemazabi.com
davar.info
elfeneri.net
elmasli.com
esnaf.tv
fotojenik.org
gecis.cc
guzergah.org
izolator.net
kagitkebabi.com
kavurga.org
kitle.org
makro.biz
malama.cc
masti.info
munevver.org
muselles.com
nefesnefese.biz
pragmatik.net
salas.cc
sovgu.com
soysop.net
tayf.net
taylak.com
tayt.info
temiz.biz
triportor.com
turdes.org
ulan.info
veresiye.net
yapay.org
yararsiz.com

4 Harf düşecek domainler;

Bu bölümde .COM ve .NET uzantılı sadece 4 harften oluşan günün düşen alan adlarını görebilirsiniz.

Listemizde rakam ve tire işareti (-) olan adreslere yer verilmemektedir.

DomainUzantıUzunlukBacklinkArchiveSon KayıtToplam Kayıt
ddse.comcom412558200212
fuae.netnet479554920023
qeun.netnet401420156
zblp.netnet4742720146
sykm.netnet401120156
tayf.netnet4362201512
aqxj.netnet4641720185
sfvc.netnet44943200612
nsfk.netnet41121200612
xsdh.netnet40920079
lhgm.netnet461120149
cwjd.netnet43567920177
cdpn.netnet49180201412
eclh.netnet401120186
jycl.netnet411920159
cgft.netnet42895520059
aben.netnet40133200056
aygl.netnet421920156
bert.netnet42342000122
blfx.netnet4142220127
bxdh.netnet411020074
deik.netnet4010200823
fchy.netnet41420139
fhdc.netnet4012201420
finl.netnet4556201715
fptl.netnet42720169
gfem.netnet401720187
gohp.netnet446120158
gpbp.netnet4010201716
ikbi.netnet40720189
lgbn.netnet40020168
lmam.netnet473120187
lyop.netnet402120106
qooj.netnet401920086
saww.netnet48125201814
tgcg.netnet404201717
tsch.netnet4028200431
vccb.netnet4126201813
vcos.netnet4025200023
vcpg.netnet40720076
vdbv.netnet40920189
wurp.netnet41791920186
xfcd.netnet40320155
yton.netnet4039201517
ywbc.netnet40520178
nggm.netnet4012201112
wjsf.netnet453920189
ljwb.netnet432820187
cymz.netnet431920185
ngpe.netnet40720187
lczn.netnet404201510
dwrl.netnet4544020117
ilgw.netnet40220185
dzns.netnet40020168
dtve.netnet402201310
gcxk.netnet40920185
ggyt.netnet44331120177
rjlf.netnet40820164
fgjs.netnet40620157
ltrz.netnet40220166
qses.netnet406201413
tugw.netnet40720183
zjbk.netnet4424351420178
azyn.netnet401120153
qaib.netnet40020186
argb.netnet4667201813
msoj.netnet421320173
qdkp.netnet40120155
jzex.netnet40120185
ejsc.netnet401020187
nogl.netnet40520189
kqyz.netnet401720164
kwrb.netnet4013201610
jhmf.netnet40720149
rrgz.netnet45031020153
ktvf.netnet40220187
rrxb.netnet4332420154
dyzl.netnet401020188
cuwl.netnet42220183
ikyc.netnet400201812
uqcl.netnet40020182
rrqd.netnet4433020154
rryb.netnet44566201510
rrzq.netnet4351020154
lgmv.netnet40820117

Backorder Firmalarından Düşen Domainler

Daha önce Dropcatch ve HugeDomains tarafından alınmış fakat x.xxx Dolar’dan alıcı bulmadığı için bugün boşa düşen alan adlarını aşağıdaki listemizde bulabilirsiniz.

bilgisayarparcacim.com
teknolte.com
kutsalhaber.com
canlicanlisohbet.com
ballibabaemlak.com
kalmeemlak.com
yagmursohbet.com
teknoadapt.com
islamitatilsepeti.com
bukleremlak.com
oyunkime.com
cemalemlak.com
dinbilgileri.com
moyunet.com
kraloyunlarim.com
stoptornado.com
springtempo.com
mantofani.com
besiktaspost.com
onurinan.com
paladiamond.com
oakislandmotel.com
modernswift.com
lazerahsap.com
bolgeseldiyet.com
astarmarket.com
planetveda.com
bodrumfiber.com
oymakinsaat.com
russianasl.com
kotacirebon.com
thundermelon.com
ranamoda.com
esenyurttabela.com
sofiakim.com
alyansmobilya.com
landespolitik.com
angelsyoga.com
simgeajans.com
recepdogramaci.com
kazakistanbul.com
lidasite.com
lovelyparfum.com
berlinpanorama.com
failstop.com
teknikbahis.com
ozgunprefabrik.com
sanalkuvvet.com
atamakina.com
aciltazminat.com
zorlutemizlik.com
onderyapi.com
yesilderekoyu.com
ergingumrukleme.com
katalogavon.com
zenginmetal.com





27 Nisan Düşecek Domainler Listesi

Aşağıdaki listedeki bul kısmına bilgi, sağlık, araba, haber, tekno, ekonomi, kadin, indir, tatil, emlak, bilet, kripto, sohbet, yemek, bebek, kitap, hediye, moda, oyun, sigorta, kredi, indir gibi kelimeleri yazarak sadece o kelimenin geçtiği alan adlarını görebilirsiniz.

DomainUzantıUzunlukBacklinkArchiveSon KayıtToplam Kayıt
yemeyenkalmasin.orgorg150020181
univerisitederadyo.orgorg180020180
signlish.orgorg80020181
sanliurfahaliyikama.orgorg1931610020181
rengarenkumutlardernegi.orgorg2314020180
megapolyapidenetim.orgorg180020180
guzelsarkisozleri.orgorg170020181
akpartiyesilyurt.orgorg160020180
vipcep.netnet60020161
upademi.netnet70020181
tekyildizteknoloji.netnet180020181
sultangazidemirdokumservis.netnet260020181
saglikhizmetleriarama.netnet210020180
reedtime.netnet80020180
rbsesl.netnet60020181
rbs-esl.netnet70020180
parspremium.netnet110020181
otovakum.netnet80020180
oraltay.netnet701120102
netcomteknoloji.netnet150020182
muratercandan.netnet130020180
metrikik.netnet80020180
megagayrimenkulden.netnet180020180
konyadadugunfotofrafcisi.netnet240020180
jdmspiriturkey.netnet140020161
jdmspiritturkey.netnet150020161
isilguzellik.netnet1231420131
iqosaksesurlari.netnet150020180
healthservicessearch.netnet200020180
hakdankoltuk.netnet120020180
goncaestetik.netnet128020181
fonmedya.netnet80020180
evlilikfestivali.netnet160020180
enerjikimlikbelgem.netnet180020120
dijitalcash.netnet110020181
deryaoutlet.netnet110020180
crmbilgisayar.netnet130020181
birlikrenault.netnet131620181
bahardabalatta.netnet140020180
araratfm.netnet80020181
amcaburger.netnet100020180
zeytinimvar.comcom110120180
yucesanmachine.comcom140120180
yillikotomasyon.comcom150520160
yenievinibul.comcom120120180
yapikredi163yil.comcom150020180
vrl-grup.comcom80120180
volkswagenyetkiliservisleri.comcom270120160
videoloy.comcom80520110
vancicekcisi.comcom120120180
ustadlarocakbasi.comcom162320180
unyeyurtbay.comcom110220180
ufukayosgb.comcom1001820160
ucyolderkomite.comcom140120180
tutkusembol.comcom110120180
turkeynanopet.comcom134420180
trabzonfenbilimleri.comcom190120180
tashihyayinlari.comcom150120181
tashihkitap.comcom110120180
surpyerortutyunkilisesi.comcom2302020150
sultangaziarcelikservis.comcom230020180
suffaesans.comcom100120180
soybilgisisorgulama.comcom190220180
soybilgisisorgula.comcom170220180
soyagacibul.comcom110620180
sosyetepetkuafor.comcom160220180
sondajkulesi.comcom120120140
sideaspendosotel.comcom160120180
seyrantepeinsaat.comcom160120180
setparkfitness.comcom140020180
sespromosyon.comcom120120180
sesdavetiye.comcom110020180
septagetruck.comcom120120180
seppethipermarket.comcom170120180
semboltutkuicgiyim.comcom180720180
sembolcorap.comcom110120180
sembolcamasir.comcom130120180
sehribazid.comcom100520180
sehmuzataysalgamsuyu.comcom200120180
sauberglass.comcom110420180
saraybuyukyoncalibozabasatilikarsa.comcom340120180
sanbotturkiye.comcom130120180
samanyolu43.comcom110120180
sahipbinden.comcom110120180
sahilkoyemlakci.comcom150120180
saglikhizmetleriarama.comcom210220180
restoreconcept.comcom140120160
resitozgurgezer.comcom150120180
reklamcikolatam.comcom150120180
rcfkargo.comcom80120180
rbs-esl.comcom70120180
promosyonlistesi.comcom160020180
prolifemedya.comcom120120180
polatligida.comcom110120160
partikultemizlemesi.comcom190120180
oncelmt2.comcom80020180
nanopetturkey.comcom130120180
mustinlondon.comcom120020180
muratercandan.comcom130120180
moskownightlife.comcom150020180
mofajeans.comcom90020180
minimalistudyo.comcom140120180
metrikik.comcom801720180
metalgaraji.comcom110820180
mersingooglereklamlari.comcom220120180
mersinadwordsuzmani.comcom190020180
melissoyutemizsungur.comcom200120180
megagayrimenkulden.comcom180020180
mavidilekgelinlik.comcom170120180
marmariskoftemis.comcom160120180
london5tea.comcom100120180
limonkuru.comcom90120181
lerababy.comcom80220180
kudretimacun.comcom120120183
kscsosyalguvenlikdanismanligi.comcom290120180
kralklimakombi.comcom140120180
kozdezurnadurum.comcom150720180
korupancelik.comcom120120180
konyadadugunfotofrafcisi.comcom240120180
kombiteknikbakim.comcom160220180
kirlangicfilo.comcom130220180
kirklarelitren.comcom140120180
kirklareliotogar.comcom160120180
kirklarelihavaalani.comcom190120180
kiralikforkliftmerkezi.comcom220220180
kaysericiceksiparisiver.comcom230020180
kahvaltikutum.comcom130120180
jadepilatesankara.comcom170120180
istanbulmasozevi.comcom160120180
istanbulkiralikforklif.comcom220220180
irayturkiye.comcom110220180
iqosaksesurlari.comcom150020180
instagramgizli.comcom140220180
imajanaliz.comcom100620180
holigancafe.comcom110020182
hncmaden.comcom80220180
hkarslan.comcom80120180
healthservicessearch.comcom2002920180
hayalimdekiferikoy.comcom180220180
hakdanissigorta.comcom151120180
gumushaneciceksiparisi.comcom220020180
gscsekerleme.comcom120120180
grupdukkan.comcom100120180
grenketurkiye.comcom130120180
grenkekirala.comcom120120180
greenleafadak.comcom130120180
gokmantarcilik.comcom140120180
giysisarayi.comcom110120180
galericom.comcom90120180
furcelli.comcom80120180
fullitistanbul.comcom141120180
foursolfarm.comcom110120180
forkliftkiralamafirmasi.comcom2376220180
fasttrainticket.comcom150120180
farmasisevgisi.comcom140020180
epeyhizli.comcom90220180
enkirala.comcom80120180
enemlaktarsus.comcom130520180
egitimliurunler.comcom150120180
egemencanyanar.comcom140820180
efemotorsistanbul.comcom170020180
duguncerceve.comcom120620180
dogramipvc.comcom100120180
dogayikokla.comcom110020180
doganaslanogluaksesuar.comcom221120180
deryaoutlet.comcom110120180
dekorasyonsarayi.comcom160120180
daikin-servisi-istanbul.comcom230220180
cropyapim.comcom90920180
coplusok.comcom80320180
cerkezkoysaraysatilikarsa.comcom250020180
cakiryapitasarim.comcom160120180
buyukyoncaliyenimahallesatilikarsa.comcom340120180
buyukyoncaliyaniklikmevkiiarsafiyatlari.comcom390120180
buyukyoncalipalamutderesatilikarsa.comcom340120180
buyukyoncalikasimegregisatilikarsalar.comcom370120180
bursatilikaraba.comcom150020180
buradankazan.comcom120020180
bolugezirehberi.comcom150120180
birtadustun.comcom110120180
birokka.comcom70220182
beylikduzuboyacilar.comcom190220180
becerilerim.comcom110120180
bcnturk.comcom72020180
balligikuluplerbirligi.comcom220120180
bahardabalatta.comcom140720180
azerbaijan100year.comcom170120180
azerbaijan100il.comcom150120180
ayzhukuk.comcom80120180
aykosanborcsorgulama.comcom20301220180
aydankahraman.comcom130120180
automaticshuttermachine.comcom230120180
assistemmuhendislik.comcom190120180
arnavutkoyarcelikservis.comcom230020180
arengrupinsaat.comcom140120180
ardahanciceksiparisi.comcom200020180
antalyacicekgonderin.comcom200220180
anqelzmt2.comcom90020180
andreamworldtr.comcom145320180
amcaburger.comcom100120180
altindamakkunefesanati.comcom220320180
almdijital.comcom100120180
aktifadanapanel.comcom15681120180
akasyatermal2.comcom130220180
akasyaprestijtermal.comcom190120180
ahsaptablom.comcom110120180
7-24kiralikforklift.comcom193120180
1seyleral.comcom90120180
1okka.comcom50020182
pixiugames.comcom103220180
basvurum.orgorg81164820181
goluizle.comcom82520180
akbuksahil.comcom1002320180
forum-alev.orgorg103720180
tolgagultekin.netnet1360020162
traxxkase.comcom92620140
zuhrufmimarlik.comcom140420160
soysop.netnet60020181
vizyon53.comcom811420160
reklamcikolatasi.comcom160120180
usluexport.netnet100020170
tedavisinasilyapilir.netnet200020171
sonsarkisozleri.netnet150420171
sehitkamilcicekci.netnet170020170
sakaryaassistline.netnet170020170
sahinbeydecicekci.netnet170020170
pobuzkyiplantofabrasive.netnet230020170
pobuzkyigrit.netnet120020171
pobuzkyi-plant-of-abrasive.netnet260020170
imocu.netnet50020171
gaziantepcicekevi.netnet170020171
fitaura.netnet70020172
dincay.netnet60020171
albayraksundurma.netnet160120170
akkakulvaryayincilik.netnet200020170
akkakulvarokullari.netnet180020170
akkakulvar.netnet100020170
yuzme-havuzu-yapimi.comcom1901120170
yuzme-havuzu-fiyatlari.comcom220420170
usluexport.comcom100120170
talhakontor.comcom110720170
sus-havuzu-yapimi.comcom170120170
surmalimusavirlik.comcom171220170
stopsecondcall.comcom140120170
sesliakinci.comcom110220170
sakaryaassistline.comcom170120170
sahinbeydecicekci.comcom170120170
rijitsismik.comcom110420170
ranjarastirma.comcom1301620170
pobuzkyiplantofabrasive.comcom230120170
pobuzkyi-plant-of-abrasive.comcom260120170
otomatiktavukyemligi.comcom200120170
optikgiz.comcom80120170
omgiad.comcom60120170
miyapsaglik.comcom113120170
minecraftda.comcom110020170
mamamatic.comcom90120170
lteaherbal.comcom100120170
liwgarkozmetik.comcom140120170
liwgarcosmetics.comcom150120170
livgar.comcom60120170
kuzeynargileizmir.comcom1701620170
kodubul.comcom702520171
kocavbayi.comcom90120170
kibrisdanismani.comcom150020170
havuz-temizleme-robotu.comcom220420170
havuz-kimyasallari-ankara.comcom250420170
frigvadisibalonturlari.comcom220120170
emkarhaliyikama.comcom157620170
elitekmuhendislik.comcom17172120170
dlivehelp.comcom90120170
cifilo.comcom65220170
canliyapim.comcom100120170
cankayaotokurtarma.comcom180120170
buyukkocmetal.comcom130120170
bunuyaparim.comcom110320170
borulusismik.comcom120120170
arsiskele.comcom91220170
arkhemarine.comcom110220170
anadolumiles.comcom120120170
albayraksundurma.comcom16141320170
akyelwind.comcom90120170
akillievci.comcom100120170
afyonbalonturu.comcom140120170
adnanerenemlak.comcom140120170
adakurwood.comcom100120170
tabanpuani.orgorg10871520172
degerlemeuzmanlari.orgorg180020172
omuutlt.orgorg70220170
ebekadin.orgorg802120171
termeavcilar.comcom120120170
ahandaburda.netnet110220171
otovakum.comcom80120180
rebornguzellik.comcom1401520180
unsalarhali.comcom110120180
hurdaciniz.netnet10212520131
kirklareligazete.comcom160020180
aydogansahabeton.comcom160120180
gaziantepaydinoto.comcom1701020180
ilginteknik.comcom110120180
classlinekoltuk.comcom152120180
studiomasal.comcom111120180
teknocops.comcom9406120160
rcskargo.comcom80120180
bepamakina.comcom100920181
kirklarelirestaurant.comcom200120180
hosturki.comcom801420180
medyacc.comcom70220180
pamukprensesperde.netnet172020170
paradoksajans.comcom131652220180
osmanbayri.comcom100220182
organik02.comcom910420150
opayreklam.comcom1001920120
newputgo.comcom80620120
msdosbilisim.comcom12410320180
mobiltakibi.comcom110020110
miymetal.comcom80120160
millimesele.comcom110620181
meleklerinelinden.comcom17159220140
limiyapi.comcom80120180
reedtime.comcom80120180
koraymimarlik.comcom1301220130
komurlukazanfiyatlari.comcom2124120160
kirklarelidugun.comcom1502320180
kiralik-kaftan.comcom145520160
karpalet.comcom831220120
kalemcelik.comcom100120170
kahvesehr-i.comcom1112020160
kahramanmarasciceksiparisi.comcom260020180
kadikoydansokulu.comcom160120130
izmirtransfer24.comcom1501920150
hasiptv.comcom70320160
handydoctorkoblenz.comcom184120160
handy-doktorkoblenz.comcom190120160
handy-doktor-koblenz.comcom204120160
haberzup.comcom8104720160
guvenlerdamal.comcom131591320140
gokhantoprak.comcom1201020120
gimhayvancilik.comcom140020180
geniselmutfagi.comcom14121120160
gaziantepkirkayak.comcom170220180
gaziantepelisciligi.comcom190720180
gaffarokkanarena.comcom160120160
fordyetkiliservisleri.comcom210120160
fastandhealty.comcom130120180
evlilikfestivali.comcom160120180
enerjikimlikbelgem.comcom1842520120
durureklamajans.comcom1511920160
dunyacicekbankasi.comcom1710172320160
drywhitelaundry.comcom150120181
deneyseltip.comcom110420160
darkdecoy.comcom90520150
coloribank.comcom100120160
cekmekoymuzikkursu.comcom180020120
cabukmuhendislik.comcom1601720170
bireyselsilah.comcom1324220160
birartibirkiralikbucapalmiyeevleri.comcom340120150
bilgito.comcom711620120
beykentkoleji.comcom130120181
bebekdeneyimleri.comcom1672320160
azizkalayci.comcom1101020110
ardaarman.comcom992520160
ahssogutma.comcom1001220110
adwordsreklamlariturkiye.comcom2401820110
adimlarimaisik.comcom140420160
724kurumsal.comcom110120160
45likberlin.comcom110120160
3dyazicimerkezi.comcom150120180
siyasalbilimler.orgorg150020161
manyaktavla.orgorg110620161
kitapzamani.orgorg1101520182
gastrikbypass.orgorg130920161
edremitkorfezhavaalani.orgorg220420101
edremitairport.orgorg140420102
bireyselsilah.orgorg1301020160
atasehirhaliyikama.orgorg1802020105
adamisi.comcom70320180
freshandhealty.comcom140120180
oyunbilgisi.comcom11322520160
kolayakce.comcom90120160
dalgicdemirinsaat.comcom1702820160
tamirciamca.comcom110820160
madamecook.comcom100120181
7-24tesisatcim.netnet1401220131
yetenekmtsk.comcom1102920130
taylak.comcom60720183
somanigem.comcom90120180
sehitkamilcicekci.comcom170620170
kafkasbambu.comcom1102820180
donanimviptemellise.comcom19288920150
quarkhome.comcom90120161
artmimarliktasarim.comcom1801620171
nedenlerinelerdir.netnet170620171
grapixer.comcom811920180
didimemlakborsasi.comcom1701920180
sahibbinden.netnet110020181
guzergah.orgorg822920182
vision3dprinter.comcom154220180
7renkpeyzaj.comcom1141520170
duvarkagidisarayi.comcom170120180
icmimarankara.comcom13111320161
ciceksatinal.netnet120020172
dostpet.netnet70020181
tierraaccessories.comcom172120150
gizemoptik.comcom100720170
adilkar.comcom7111120150
giyimlife.comcom902820140
btsyapi.netnet7170562420121
studyo81.comcom801420150
danskampusu.comcom1164220130
turkiyesorubankasi.comcom180120150
aydanonline.comcom110120180
ucretsizmatematik.comcom171520180
aracmuayenerandevusualma.comcom2481520170
dorduncuyol.orgorg11226920122
termetv.comcom70120170
3dprintmerkezi.comcom140120180
duccaconcept.comcom120120180
gaziantepucakbilet.comcom181820180
tikaniklik-acma.comcom150620171
dstmachine.comcom10172620100
kurumsalseodanismanligi.orgorg23271920181
omsiad.comcom60820171
turkishmeerschaumpipes.comcom22422720170
norbexyapi.comcom100720180
ibrahimoglunakliyat.comcom1902220161
temizlikuzmani.comcom1404020171
balikesirsatilikdaire.netnet210220183
umraniye-klimaservisi.comcom2101720170
modavrupa.comcom901720150
pvcdogrami.comcom100120181
yatirimtavsiyesi.comcom160620170
dogusofficial.comcom131373420120
dugundefotograf.comcom1562720180
sulamasepeti.orgorg120920140
bypoyraz.comcom80520180
fonmedya.comcom80920180
kodolog.comcom701320170
kirklarelibilet.comcom150920180
eximer.orgorg602201812
asansorsirketi.comcom1402720140
tetradrill.comcom1001020150
istanbuldekor.orgorg13214420152
keyifburada.comcom1102920170
aytemkimya.comcom1001420180
senfilmizle.netnet11425820131
boruavm.comcom70720180
boruavm.netnet70720180
erzurumciceksiparisi.comcom2011520180
amasyaciceksiparisi.comcom1901120180
araratfm.comcom80120181
zirvemetin2.orgorg110720181
kirklareliyatirim.comcom170320180
sembolicgiyim.comcom130820180
lilacicekcilik.comcom14232720171
netdefterim.comcom11692620170
gumusvitrin.comcom110420180
baldiz.netnet667020184
seckin-grup.comcom110820180
asilkozmetik.comcom1202020180
beyazkumfm.comcom1046620160
kayserises.comcom101220180
drsguvenlik.comcom1112820100
esigaramarket.comcom132056620124
dugundefotograf.netnet15141320180
mezuniyettoreni.comcom1501320160
sultangazivestelservisi.comcom230120180
arnavutkoydemirdokumservisi.comcom270120180
sututucu.netnet80320171
ankaraoffshore.comcom1401320180
istanbulmoderntente.comcom190120160
ogderkocaeli.orgorg122401820180
kufret.netnet61820181
habercin.orgorg801020173
dkyazilim.comcom9133320170
halistv.comcom72821220110
grppipe.netnet76120187
beklemem.comcom8271020150
imartur.comcom70820180
hepsihemen.comcom1001120160
sigortaevi.netnet100820182
yenigorgunmuzikhol.comcom1802120150
pipemall.netnet80820182
ararsanbulursun.comcom1501920121
sahibinten.comcom100920185
sultangaziboschservisi.netnet220320181
beylikemlak.comcom1101920120
kamuislemleri.comcom1302420120
lilacicek.comcom913020170
klmroyal.comcom802520171
aydin-insaat.netnet1202620162
forkliftkiralamamerkezi.comcom230220181
balayitur.comcom90820180
pro707.comcom601120160
hepsikazancli.comcom130820160
kirklareliilan.comcom1402220180
camerasoftware.netnet1401020114
sesligaste.netnet100020171
vpills-gold.comcom1101620130
malatyayerel.comcom12278220181
hacklink.netnet82930239201720
serisonutekstil.comcom150120180
elektroniksat.comcom1326330120180
netaturkey.comcom1002920170
cebecigayrimenkul.comcom1701420140
food-recipe.netnet11131720820118
yenimezunum.comcom110820180
kupcuoglu.comcom90520181
arnavutkoyvestelservisi.comcom230520180
ankara-grotto.comcom1312120180
halborsasi.comcom1001020180
yapay.orgorg54441201821
kitle.orgorg5267720187
iso18001.netnet801420129
burakdemiral.netnet12103667020101
izolator.netnet8819201511
7uz.netnet32123201111
esamsun.comcom723420111
demirkolinsaat.netnet1413320171
arnavutkoyboschservisi.comcom22749820180
kbbdoktor.netnet901020091
ivmeegitim.comcom104420151
ankaravizyonpeyzaj.comcom1816620100
bizimaskimiz.comcom1283720181
ithalburada.comcom110320181
yavuzkoltuk.comcom1102020171
mapiy.comcom50020171
poyrazsesli.comcom1111020180
kayserisandalye.comcom1501220180
sunclubbodrum.comcom1352720170
duygusalhaliyikama.comcom18735720180
vaillantkombiservisi.comcom2011850201010
ankaraemekcivata.comcom1662820180
birsatis.comcom803120180
esdry.comcom50220180
anasefkat.comcom9823320090
hepsiturk.comcom901420050
beyaztekstil.comcom1244320171
barsinlondon.comcom1203520181
sesliseker.comcom1021820120
e-lg.comcom404520185
ruyaipekli.comcom100920080
ozgungrup.comcom9386820061
egitimeri.comcom913820070
kocavbayii.comcom1001220170
prizci.comcom60820180
eminogullarimakina.comcom18904820070
videoizle18.comcom1122120183
gaventekstile.comcom130020090
emofc.comcom5828520090
ekmekvegazete.comcom133015920090
thorcelik.comcom90020160
wanderinistanbul.netnet160020161
ukibris.netnet70020181
stilklik.netnet80020180
soyagaciolustur.netnet150020180
sanlitekstil.netnet120020122
percesusinteractive.netnet190020181
omega61.netnet70020181
nemosgardenturkiye.netnet180020180
nemosgardenturkey.netnet170020180
nemosgardentr.netnet130020180
mobilchati.netnet10340120180
merpolin.netnet80020121
kemekebap.netnet9241120110
hacibektashaber.netnet150020151
fayajans.netnet80020181
farmasikatalogkayit.netnet190020183
elsebilisim.netnet110020181
ekolilaclama.netnet120020132
eftenigrup.netnet100020181
eczanemegelsin.netnet140020152
blackseatrout.netnet130020181
armaturkey.netnet1001120101
alkiminsaat.netnet110520181
yigitins.comcom828733220180
yemolim.comcom70120180
yazarlarkupasi.comcom140020160
wallmond.comcom80120181
vclfilokiralama.comcom150120180
uyurtdisiturlari.comcom160120180
uysalhurda.comcom100420180
ustalikeserleri.comcom150120180
usawrnews.comcom90020180
updownsafari.comcom120120180
umutaksesuarmobilya.comcom191420160
ugerkablo.comcom90120180
ugemiturlari.comcom120120180
udevyazilim.comcom11865120180
ucuztoptanciniz.comcom150120180
ucruiseturlari.comcom140120180
turkiyeteknolojivakfi.comcom210120180
truvagolevleri.comcom140220180
tiptopmood.comcom100120180
tiarge.comcom60120180
temakmakinakalip.comcom160820150
tedarixml.comcom90020180
tarsusveterinerlik.comcom180120150
tarimvehayvancilikmagazin.comcom250120180
svgaco.comcom60020160
sufiquiz.comcom80120180
stilklik.comcom80120180
soybilgisi.comcom100020180
soyagaciolustur.comcom151220180
soruncozmemerkezi.comcom170220180
solfisol.comcom80120180
sigmainsaatdz.comcom130120180
servismer.comcom90020150
serkancivelek.comcom1302920092
senfoniakustik.comcom140220150
sehalsan.comcom80120180
sayiliroglu.comcom110120180
sayarholding.comcom120020180
rota-altay.comcom100120180
psgmerkezi.comcom100020150
psgmer.comcom60020150
projeessa.comcom90220180
posetiacilmis.comcom130120180
plazmakimya.comcom1101120140
phoenicinvest.comcom130120180
ozgesomakli.comcom110020180
omerorakci.comcom100220180
neseliadam.comcom100020180
nemosgardenturkiye.comcom180120180
nemosgardenturkey.comcom170120180
nemosgardentr.comcom130120180
mekasanasf.comcom100120180
masalkasifi.comcom110120180
kutusuacilmis.comcom130120180
kurumsaletz.comcom110120180
krpmining.comcom90020180
konyaaltiremaxaqumetehan.comcom240120180
konakiskembecisi.comcom160120180
kebapnagme.comcom100120180
kavurmaciosman.comcom140020180
karadenizalabaligi.comcom180120180
k2patent.comcom80120180
instcb.comcom60020180
hayatkobiliyeguzel.comcom180120180
hayatkobilereguzel.comcom180120180
hangieglence.comcom120020180
hangiapartman.comcom130020180
hangiaktivite.comcom130020180
gozlukbakalim.comcom130020180
goldparkresidence.comcom170120180
gidonkilidi.comcom110120180
geyikliegitim.comcom1317120180
gebzeinternetsitesi.comcom191120180
gazozsarayi.comcom110120180
gazozpoint.comcom101120180
galeri-anka.comcom110120180
farmasikozmetkdunyasi.comcom210020180
farmasikozmetikdunyasi.comcom220220180
fantazimon.comcom100020180
eyjabahis.comcom90220180
etzkurumsal.comcom110120180
eslemkaraca.comcom110120180
enstrumanyedekparcalari.comcom230120180
enigmapool.comcom100120183
emlak-alsatkirala.comcom170120180
elveremlakdanismanlik.comcom210020180
eftenigrup.comcom1002020181
eftenigroup.comcom110020180
eflalmoda.comcom90120180
eessjournal.comcom110120180
e-teknolojidestegim.comcom190020180
duygubozart.comcom110120180
drselmaestetik.comcom140220180
doxaline.comcom80120180
dogruyolhaber.comcom130120180
dkaahsap.comcom80120180
corlukekemelodi.comcom151120180
clmturkiye.comcom100120180
clmkilit.comcom80120180
clmistanbul.comcom110120180
caylabizi.comcom90020180
capulafashion.comcom130120180
canankaram.comcom105320180
bythbr.comcom60120180
bosphorusdailycruise.comcom200120180
bonnaline.comcom90120180
bingoldcoin.comcom110120180
atestakip.comcom90120180
arazitarlaarsa.comcom140120180
araziarsatarla.comcom140120180
animgraf.comcom80520180
anatoliaegitimdanismanlik.comcom250020180
ambalajiacilmis.comcom150120180
amazonyapi.comcom100120180
altininsaatkarapinar.comcom200120180
ahenkkekeme.comcom110120180
adanaradyoreklam.comcom1610120180
adanagazeteilan.comcom150120180
adakanvastablo.comcom140220180
3dkesicitakim.comcom130220180
17napolipizza.comcom130020180
kiymadoner.comcom100020180
tahtyapi.netnet80020182
tahtkonutlari.comcom130120180
tahtevleri.netnet100020180
tahtevleri.comcom100120180
hangikuafor.netnet110020181
cienas.comcom61120181
tipobet1000.comcom113020181
tunektepe.netnet90020172
tekniksanat.netnet110020172
tasyunusove.netnet110020171
sebepsia.netnet80020170
milleniwifi.netnet110020170
focustechnic.netnet120020170
eurosmed.netnet80020174
bulutvayfay.netnet110020170
yanmazsove.comcom100020170
yanmazmantolama.comcom150020170
vavienajans.comcom110120171
soundofdenim.comcom120020170
sosyaletkinlikmerkezi.comcom210020170
sistemexport.comcom120020170
sigilankara.comcom110120170
sesabutikpasta.comcom140120170
sarisibeyazi.comcom120020170
prmavie.comcom73620170
nrcelayakbakim.comcom1441620170
nkolaytesekkur.comcom140020170
nkolaykargo.comcom110020170
moniden.comcom70020170
mkreklamcilik.comcom130320170
milleniwifi.comcom110020170
kavacikalabaliksofrasi.comcom222220170
kanzbabyshop.comcom120020170
fsptrading.comcom100220170
eroldoganavukatlik.comcom180020170
elicaantalya.comcom120120170
dokuzagacyapi.comcom130020170
derinsuyachting.comcom150520170
ctmgida.comcom70120170
cizimdenmetraj.comcom140020170
cinaryapigayrimenkul.comcom200120172
bulutvayfay.comcom110020170
aslanbeykayisi.comcom140020170
antalyabilimfestivali.comcom210020170
akcabelenseker.comcom140220170
akbazgida.comcom90020170
adafarmsol.comcom102920170
a1yanmazsove.comcom120020170
a1yanmazmantolama.comcom170020170
airsoftss.comcom90020180
enigmapools.comcom110120180
rosainsaat.comcom100020170
gebzeinternet.comcom130120180
hardpull.netnet80420182
polatgroup.netnet100620103
uygunpatent.comcom110020130
spor17.comcom601020110
armaturk.netnet801220102
firmadefteri.netnet120220171
adafinans.netnet911820153
espressocuppa.comcom130320180
kaphack.comcom70220180
tabelaimalathanesi.comcom18161420170
s-hillbilisim.comcom130120180
yakamozmasaj.comcom120220180
fullambar.comcom901420180
ubiletal.comcom80420180
artsahne.comcom80120180
sebepsia.comcom80720170
textilport.netnet100020172
ozkanbyperilla.comcom140020150
ozkanby.comcom70020150
ozkanbey.comcom80020150
ozkanbay.comcom80020150
otobusaskim.comcom110220160
olympusled.comcom100320160
mukavvamarketi.comcom140120160
modernsanatakademisi.comcom2002920150
suticenmimarlik.comcom1502820150
melitapelle.comcom110120150
markasehirlerzirvesi.comcom201024020150
liquidgluestick.comcom150020140
lazikakitap.comcom110020170
kuzeytekniklazer.comcom1611520140
kosovali-saat.comcom1301320130
koldasplastik.comcom1301120130
kokcuoglukirtasiye.comcom180020150
kemekebap.comcom90120110
kecebijuteri.comcom120020140
kartvizityolla.comcom140120180
istprt.comcom60020160
fulldeckdekor.comcom131720180
huseyinyayman.comcom1333020150
htcdekorasyon.comcom1302720170
histoflex.comcom90120110
hangirobot.comcom100020180
guneydogukovan.comcom1411620160
generalpvc.comcom100020141
gebzebebeksekeri.comcom160020160
fethiyeucakbileti.comcom170620110
expresslezzet.comcom130020160
ersenyatcilik.comcom130020110
emlakyolda.comcom102520150
emeksoykimya.comcom120120120
emeksoy.comcom70120121
ebatmukavva.comcom110120160
dwgmetraj.comcom90120120
docagroup.comcom91920156
denizliklimaservisi.comcom1901220100
comdonati.comcom90620120
boykilohesaplama.comcom160120160
begumtoys.comcom904120120
bebe-soft.comcom90020121
atlasicgiyim.comcom120020150
arnavutkoykelepir.comcom170120130
annesiylebebegi.comcom1502020180
ankarakinasalonu.comcom160020160
ankarakinaorganizasyon.comcom220620161
ankarabindalli.comcom147320160
aliakcan.comcom801120072
alcaminsaat.comcom1101420120
kanvasevim.comcom100220181
uyeolma.comcom70620180
gifboothturkiye.comcom150120160
lidyaphotography.comcom1601720180
clmturkey.comcom90120180
balcigayrimenkul.netnet160620171
dugunmuzikleri.comcom140720170
tasyunumantolama.netnet161020171
focustechnic.comcom120420170
boyutspor.comcom901020180
360interaktif.comcom13501720130
sahtana.comcom76420180
yusufkahveci.comcom120520150
ucboyutluyazicim.comcom160120180
sehirdemoda.comcom110120180
omega61.comcom70120181
hasdemirdograma.comcom151220180
baydarmedikal.comcom133520180
boyasizgocukduzeltmemerkezi.comcom270120170
saricantarim.comcom1219920180
tcavm.comcom50120180
motosikletkilit.comcom1501520180
rafetsolakoglu.comcom140120180
kayakoyu.comcom80620170
kajukenbokarate.comcom151420170
duruicgiyim.comcom110020150
temisgemi.comcom90720180
manavgathurdacilar.comcom180420180
celikismetal.comcom120120170
macayorum.comcom988620150
bakgidiyor.comcom1013020140
esabder.netnet70220180
gulizvural.comcom1001420180
petomat.comcom70620171
kristalbilardo.comcom1401220150
eniyisepet.comcom100520150
hangiguzelliksalonu.comcom1901120180
gkport.comcom662620171
tr-sohbet.netnet9291920182
markaerkek.comcom1011320180
gumuskaynak.comcom110220150
haberjim.comcom8173220180
evaliyoruz.comcom100120180
cantamiseviyorum.comcom1651520180
dugunsalonumuz.comcom140320181
rreklam.comcom703020160
jetotokurtarma.comcom140220180
feo2.netnet483420124
dysonsupurge.comcom1221620160
gulerda.comcom70220160
kirsehirsecim.comcom1301520181
ebrulimasaj.comcom11352520170
maratonevdenevenakliyat.comcom23455820110
elegancesuit.comcom1201320170
finaltaban.comcom1001120130
ankaramobilyadekorasyon.comcom2361720180
bakoptik.comcom831020180
hayalsitesi.comcom1131320180
izmirshop.comcom90920171
ertangiritlioglu.comcom160120171
move2turkey.comcom110020170
kajukenboturkey.comcom150120170
asyapigrup.comcom1001620131
sinbadonline.comcom1201020180
direksiyonkilidi.comcom160120180
espressocup.netnet110220189
phoenic.netnet70320184
millihafiza.comcom110120180
aylinyavas.comcom1001120180
esabder.comcom7795120180
enyakintamirci.netnet140020181
41market.comcom80220181
esporhaber.comcom1004320152
adamagazin.netnet103620182
elfeneri.netnet826520162
tayf.netnet4362201512
kahramanlardunyasi.netnet180920092
biletur.comcom701320121
meridyengrup.comcom1201020092
sanalstore.comcom10177620150
bafrasohbet.comcom11318320090
almiralazer.comcom1101920090
polikarb.comcom821720172
elyapbakir.comcom10163120090
paratonerci.comcom1101120170
duyangroup.comcom1096920180
polinitkart.comcom1133320180
bilgibelgesistemleri.comcom20142620110
faikselcen.comcom1012920170
yatirimciya.comcom110220180
plazmatarim.comcom1101220140
akgunmedya.comcom101787320131
gozluksitesi.comcom1212820180
mimodemimarlik.comcom143252520160
gencfotografcilar.comcom172996020090
filmgazetesi.comcom122320151
iymon.orgorg501520183
hayvanheykelleri.orgorg160020180
fabrikafe.orgorg90020181
yatirimdanismanlari.netnet190020180
viyaemlak.netnet90020181
utopiartist.netnet110020181
ucuziyi.netnet70020131
soyagacisorgulama.netnet170020181
lazerkesimkorkuluk.netnet180020181
ipfclinics.netnet100020161
implanterpen.netnet120020160
edzconsult.netnet100020180
durmapay.netnet80520132
ceptelefonusigortasi.netnet200020160
cepsigortasi.netnet120020160
celikbaslar.netnet110020140
celikbasgrup.netnet120020140
bizimmasallar.netnet130020180
ardicalankoyu.netnet130020140
zuhalleyoga.comcom110020180
zuhalileyoga.comcom120020180
yuzyilsosyalhizmetler.comcom210120180
yogasanatr.comcom100120180
yildiz-insaat-discepekaplama.comcom280820180
yazdirgelsin.comcom120020130
yatirimdanismanlari.comcom190020180
uvbaskishoop.comcom120020180
urorob.comcom60020180
uluslararasigroup.comcom170120180
tronikakademi.comcom130020180
temelindehayatvar.comcom170020180
tedagrup.comcom80120180
smartkompresor.comcom140220180
sifaellerimde.comcom130520180
shoperrotik.comcom110820180
sekersanatmuzesi.comcom160220160
safranboludugun.comcom150020140
radyoekipmanlari.comcom160120150
poset-fiyatlari.comcom150020180
pizzamany.comcom91020180
payacco.comcom70020180
nbookar.comcom70020180
mybaggaj.comcom82220180
mommybiodough.comcom130020180
mobilozelegitim.comcom150120180
mgoktayogluasm.comcom140420180
malatyakoskcigkofte.comcom190220180
makeupnil.comcom90120180
logoyazi.comcom80020180
kapaklihaliyikamatesisi.comcom230020180
journalofchildrenswriters.comcom250020180
hasdelta.comcom80020180
gratype.comcom70220180
gpmtr.comcom50220180
futuristler.comcom110320180
feslihanbasaksehir.comcom180120180
feslihan.comcom801520180
fatihyavuzpremium.comcom170020180
fatihyavuzhome.comcom140020180
dondurmaciaysekadin.comcom190020180
dildelezizkunefe.comcom160020180
deliokur.comcom80020180
chpileortakakil.comcom150020180
cancigerselo.comcom120120180
canakkaleyifenerbahceyegetirdik.comcom310020180
canakkaledebirhilalugruna.comcom250020180
caglarkentbozuyuk.comcom170320180
bizimmasallar.comcom130020180
banukestim.comcom100020180
alkentgida.comcom100220180
aelitebeauty.comcom120020180
banayakisir.netnet1113620181
ahmetkozan.netnet100320181
umgef.netnet50020170
denizlisehirhastanesi.netnet210020171
bidunyahizmet.netnet130020171
vbssistem.comcom93120170
umgef.comcom50020170
uitcert.comcom70020170
toppointconsult.comcom150220170
proteintozu7.comcom1201720170
mizikaturkiye.comcom135520170
kebanotoboya.comcom120120170
isvectupbebek.comcom1301420170
ibsasansor.comcom100120170
huseyinyayla.comcom120720170
benimfirin.comcom1022920170
atameragro.comcom100120170
aktuelkocluk.comcom1202720170
egitlence.netnet92220104
stillvagonu.comcom110020180
mesmiracles.comcom110020170
zaferstore.comcom100120180
eczanegross.comcom110120180
emlakcadisi.comcom110020180
yogacim.comcom70020180
pandoraboya.comcom110520131
muselles.comcom801320050
metin2kayit.comcom1136720160
lepisode.comcom80520122
konforburada.comcom120120160
kasimogluturizm.comcom150020160
karabukdugun.comcom120020140
intekspo.comcom801720150
implanterpenfue.comcom150220160
hizmetnimettir.comcom1401620080
hasanemreozer.comcom138320160
gokkayapark.comcom110020150
gaziantepemrecicek.comcom180220160
galvanizcelikkalas.comcom1804720170
egmelektrik.comcom110620180
etimesgutsihhitesisat.comcom2101520180
erkozinsaat.comcom110120160
edzconsult.comcom100020180
delimikrofon.comcom120020161
celiktribunyapimi.comcom170020120
celikbasgrup.comcom1262020140
bitekmakina.comcom1101020150
aztinsaat.comcom90120150
ortamizleme.orgorg110020102
esenlerbekoservisi.orgorg1801720112
epohder.orgorg755820150
bagcilarbekoservisi.orgorg1902420112
mukaddeshukuk.comcom13714720150
pizzagetir.comcom100720170
belissamobilya.comcom14272820160
tumsaninsaat.comcom12660720130
cayirovacemevi.comcom1401120180
implanterpen.comcom120020160
cementurk.comcom902120161
bozturkmesrubat.comcom1501320160
ankarapsikologleventduran.comcom2501720140
kitchenaidyetkiliservisi.netnet242620181
fotokitaplar.comcom120120150
feyapimimarlik.comcom140120170
moninerede.comcom1023920140
ilkerkocager.netnet1213520140
cinfikri.comcom83120170
shipshak.netnet80420172
myasist.comcom701120180
ledalsak.comcom80420170
reklamic.comcom814520180
messcloud.comcom90320181
patistan.comcom80020140
aynayabak.comcom901020170
restaurantcalifornia.comcom200720170
mustafahasturk.comcom14565220131
haberm.comcom6285520091
pompamodelleri.comcom140220180
ankafotokopi.comcom1213920160
plastik-poset.comcom1301420180
mutluauto.comcom91185820100
vartasgroup.comcom1101020130
ortakakilplatformu.comcom180920180
turkeymachineryguide.comcom20582020050
kolibantlamamakinesi.netnet200120130
pendikfirsatlari.comcom160020140
ozelkadinlar.comcom12121914420180
celikbaslar.comcom110920140
monmiracle.comcom100020171
sospecial.netnet9125201212
karyateks.comcom912625920170
efirma.netnet6035201527
ceptelefonusigortasi.comcom200120160
cepsigortasi.comcom120120160
myasist.netnet73420180
partialisverisi.comcom150920180
avcilarsatilikdaire.comcom190720120
ucuzyolculuk.comcom120420150
dizisiteleri.comcom1201220130
muratsenay.comcom100520180
plastikkirmamakinasi.comcom20704020160
ciltlekeleri.netnet1242020183
sovgu.comcom501020180
rehberbeylikduzu.comcom16123520120
girisimfikri.comcom12262820170
ozkayalardemircelik.comcom1901120180
soorgu.comcom601620180
exibilisim.comcom1003620150
gebzeevdenevenakliye.comcom20288120162
artimutfak.comcom1032120151
kirmamakinasi.comcom13711920160
hepsiafyondan.comcom1301720180
arsasatilik.comcom1122920160
hevesbilgisayar.comcom1521220160
birmedya.comcom812020151
serenvesamet.netnet120220180
enginaar.netnet81220181
xoepanel.comcom832720160
umutkuzucanli.comcom130120180
turkiyekobizirvesi.comcom180020180
tokkompozit.comcom110120180
salas-balik-restaurant.comcom220120180
pirlantaaltinmarket.comcom190620180
ovenbilisim.comcom112020180
muhendisatolyesi.comcom16691120180
kriptohaberi.comcom120520180
konutprojebulteni.comcom170220180
kolayalisverissepeti.comcom200120180
kbealuminyum.comcom120120180
hekimliktebirlikvehaklar.comcom240120180
esrasmmm.comcom80020180
enessakar.comcom90020180
emrebilgeyiseviyor.comcom180120180
emiraglamaz.comcom110120180
emaplastik.comcom100120180
dalamancati.comcom110720180
cevizlibahcem.comcom130120180
baskipaleti.comcom110120180
alperenarici.comcom120020180
akcanhalikoltukyikama.comcom210520180
satansahibi.comcom1128820140
yotbit.netnet62520181
platinmucevher.comcom140420180
rivafuar.comcom80020170
rivafair.comcom80020170
marmarabolgesindesatilikkiralik.comcom3111021420170
karadenizbolgesindesatilikkiralik.comcom339301420170
istanbuldiniorganizasyon.comcom240120171
icanadolubolgesindesatilikkiralik.comcom3310601220170
expresperde.comcom110320170
egebolgesindesatilikkiralik.comcom27483461420170
akdenizbolgesindesatilikkiralik.comcom316711420170
sahibindenkonteyner.netnet190020181
pdf-kitapindir.comcom140520180
osmanogullarikuruyemis.comcom2201220130
odemisbirgi.comcom1163920150
kgmmp.comcom50120182
kadifekapliyasin.comcom160920160
hueztasarim.comcom110120160
alperenunal.comcom110020180
cicekhediyem.comcom120220180
agrolal.comcom70120150
onetoonepilates.comcom1511320171
hayalbebe.comcom90220170
rivafuarcilik.comcom130020170
softsetup.netnet90420182
ozzby.comcom502720181
gebzeiselbiseleri.comcom170220180
tasfirinlahmacun.comcom163720180
tatlikalpler.comcom121220180
revansu.comcom702020171
onayiletisim.comcom124220170
lemonwraps.netnet100020184
o09.netnet314620187
evramusic.comcom941020180
captekno.comcom80020180
trtvhaber.orgorg90020182
teknolaz.orgorg80020181
futureteknologik.orgorg160020180
xxxsohbet.netnet90020180
niluferemlakofisi.netnet170020181
kriptotoken.netnet110020181
haberma.netnet702220161
erkenrezervasyontatil.netnet210020091
elzemsohbet.netnet110020180
bebektepisawah.netnet140020131
aynaemlak.netnet90020181
amhaber.netnet70020181
actiontoyuniverse.netnet170020180
xcamsohbet.comcom100120180
workrediviva.comcom120120170
thremlak.comcom80120180
telefonda-sohbethatti.comcom210620180
teknolojikmck.comcom130120180
sayemlakinsaat.comcom140120180
samsunmaviemlak.comcom150420180
ozhakikiankarabarosu.comcom200120180
nusantarabaliliving.comcom190120180
npratikkredi.comcom120520180
kuleemlakbursa.comcom140120180
kirmiziemlak34.comcom140120180
kazanimtestleriindir.comcom200120180
kaanemlakantalya.comcom160220180
hoppilyeverguzman.comcom170220180
haberlerbursada.comcom153820180
guleryuzemlakankara.comcom190120180
gezginebilet.comcom120120180
fedaiemlak.comcom100120180
emsalemlakduzce.comcom150120180
elzemsohbet.comcom112120180
eliteknollen.comcom120120180
efendibilgisayar.comcom1603020180
ebatestleriindir.comcom160220180
datcamacunuindirim.comcom180120180
canbabaemlak.comcom120120180
bulutemlakortaca.comcom160220180
bornovabilgiparkianaokulu.comcom2501120180
bolatogluinsaatemlak.comcom200120180
asilinsaatemlakdanismanlik.comcom260120180
akankarabarosu.comcom140120180
rutinasparabajardepeso.comcom2211720111
haberfeldtaf.netnet120020170
temellicanemlak.comcom1512020111
whathaber.comcom90320170
evseemlak.netnet90020171
focademeteremlak.comcom160120170
gelisimemlakinsaat.comcom180120170
oyunubirakma.comcom120120170
enriqueguzmansolar.comcom180120170
meralemlakkirklareli.comcom200120170
haberinkartali.comcom140620170
ozelhaber.netnet912620085
livayemek.comcom901320180
ustunkayaemlak.netnet140020181
yangtaoyun.comcom100120160
teklinkoyundeposu.comcom1762220181
yakinsohbet.comcom115220180
bursamhaber.netnet110620181
sengulemlak.netnet110620181
karakutukitaplari.comcom170120180
mostatil.comcom803320081
metropolemlakinsaat.comcom190720180
mchaberberger.comcom130220160
maltepekorkuoyunu.comcom1731720180
lifemindir.comcom1002420150
indirtikla.comcom100120130
haberfeldtaf.comcom120120150
haberbet.comcom8841320160
emlakkafesi.comcom1101620180
dizgihaber.comcom100520150
maxadinekonomi.comcom140120160
bilgisayarparcacim.comcom180120180
ayvalikbasakemlak.comcom17477620180
asarcikinsaatemlak.comcom180120160
architeknology.comcom1401320100
alakussigorta.comcom130820180
kibaremlak.netnet101020181
teknolte.comcom8264820180
galeriajoaquinguzman.comcom200020180
xiaoyunzhiban.comcom130120180
rtvhaber.comcom834320140
fdbilgisayar.comcom120020180
guzmanhosting.comcom130120160
gundelikhaberler.comcom1601620180
animehaberleri.comcom140920180
ateslisohbettr.comcom1412720180
fktekno.comcom702220170
enbabahaber.netnet110420181
hooyuno.comcom70920150
wowtatil.netnet80520091
wowdatatil.netnet100620091
jagoantekno.comcom1131920180
btteknoloji.netnet1102520183
indiroses.comcom90120170
oyuncakbu.comcom90120180
guncelhabersitesi.comcom1702620181
ukashuzmani.comcom1153320140
kutsalhaber.comcom1101720180
xxxsohbet.comcom948531620180
uyuzoyun.comcom825110720180
teknolojisel.comcom1203520181
gapemlak.comcom812220170
tntteknoloji.comcom120720170
akbebek.comcom701620180
cinselmagaza.comcom1205920170
cinselsohbethatlari.comcom1984520180
ruoyuntang.comcom100620170
canlicanlisohbet.comcom160820181
ceptensicaksohbet.comcom1741320180
totemlakevisioncenter.comcom212820080
asyapiemlak.comcom113920180
autokrediet.orgorg111344201110
hittarabattkod.comcom147420181
ballibabaemlak.comcom145220180
aloucuzbilet.comcom1202220131
beskitap.comcom80120180
mysohbetr.comcom9303520180
emlakarayalim.comcom130020110
teknowindow.comcom111220180
garantioyun.comcom11168920171
pastillasparabajarpeso.comcom226211020130
duhaemlak.comcom911320132
sohbetinadresi.comcom1401320130
kalmeemlak.comcom10141520182
yagmursohbet.comcom1213320162
bilgicafe.netnet913620141
erhanbilgisayar.netnet1501120071
teknoadapt.comcom104282720181
hediyekeyfi.comcom1178220180
didimbaskentemlak.comcom1705620170
haberci41.comcom917512420180
islamitatilsepeti.comcom170120180
bukleremlak.comcom1113220181
kocaelihaberler.comcom15182820161
oyunkime.comcom802120181
cemalemlak.comcom1002420160
videolarabak.comcom1201820180
indirbe.comcom737120172
dinbilgileri.comcom1206220160
moyunet.comcom715020182
kraloyunlarim.comcom134016120180
churaaya.comcom80020170
guardaposta.comcom110020190
romesali.comcom80020190
lalesune.comcom80020190
istenaco.comcom80020190
mailsana.comcom80020180
tonymarihuana.comcom130020180
flokadastore.comcom120020180
agriquito.comcom90020180
okayamasakura.comcom130020180
ucuzroman.netnet90820080
traviskubik.netnet110020161
tonypartner.netnet110020181
tisburyprinter.netnet140020181
starheroes.netnet100020163
sisedolum.netnet90020121
sarasotabikes.netnet130020181
samsundisli.netnet110020181
salonaurora.netnet110020143
pepperfire.netnet1001420116
panamayapi.netnet100020181
nergisakinci.netnet120020141
mandaleon.netnet901020141
mailyedek.netnet901120051
lakesomerset.netnet120020183
kraltavuk.netnet90020181
kovamedia.netnet90020182
incidentcentral.netnet150020181
greatlakesvideo.netnet150020181
estatemarmaris.netnet140020121
dominantplan.netnet120020180
dogumekanik.netnet110020182
ceylandekor.netnet110020181
annamarndunn.netnet120020181
amberelliott.netnet121020183
zionmodelstudio.comcom150220180
zarapoint.comcom90020180
yogurtspotmiami.comcom150120130
yesimbufe.comcom90120180
vistasperm.comcom100020180
vidavidasalon.comcom130220180
vegaseri.comcom80120180
ustasporcu.comcom100420180
urbansparta.comcom110120180
unionveca.comcom90220180
ucuzroman.comcom901020080
turuncuelektrik.comcom150120160
torcuatoglobal.comcom140220180
tipistream.comcom100120180
talkforadollar.comcom140120180
takipabone.comcom100120180
tabletnewcanaan.comcom152220180
suniforum.comcom90720141
sonekart.comcom80020180
sillapapa.comcom90020180
siliconeforhome.comcom150120150
sifontamirci.comcom120020180
saunagoirle.comcom110020121
saturnbridge.comcom120020180
sarayanittepe.comcom130120160
santiyedenetim.comcom140120180
sanibeautysalon.comcom150120130
sandwichslogan.comcom140120180
sametkalayci.comcom120120180
roxburyglobal.comcom130020140
rotortogo.comcom919620180
romantoribio.comcom120120180
reddeermenus.comcom120520090
rahmankeles.comcom110220180
projectkuru.comcom110620160
pomeranianforum.comcom1501220072
pointsonearth.comcom130120130
plastikmarpuc.comcom130020150
planitai.comcom80120180
pasogezi.comcom80220180
papabreezy.comcom100120180
panoramamedan.comcom130220180
palathum.comcom80020180
optimummexico.comcom130120180
nouvellemoda.comcom120020180
nidarahim.comcom90120180
nicholsonrisk.comcom130120180
namecrossings.comcom130120180
muratkement.comcom110220180
mizansulaiman.comcom130120180
midebaron.comcom90020180
memeterritory.comcom130220180
mekanmudavim.comcom120220180
masajvitrin.comcom110820180
masajsayfa.comcom100120180
masajokyanus.comcom120420180
masagees.comcom88531120180
martinsanka.comcom110120180
mangaleno.comcom90520180
lodigram.comcom80220180
lensatak.comcom80220180
lasobasi.comcom80020180
lalaborn.comcom80120180
kulotbatik.comcom106120180
komunister.comcom100120180
kirimmail.comcom90020180
kirakeller.comcom100120180
kabalaglobal.comcom120120180
fondabryant.comcom110120180
esmemetalhurda.comcom140020180
enfieldstar.comcom111020180
elementizmir.comcom120120180
elementankara.comcom130120180
eldeporteblanco.comcom150320180
eksiokul.comcom80120180
doctordelta.comcom111520180
daviddeer.comcom90120181
creditdoum.comcom100120180
coinzade.comcom80220180
coinozon.comcom80120180
chocosuples.comcom110120180
centraldentalaz.comcom150120180
briczart.comcom832520180
bordohurdacilik.comcom150020180
bonnplan.comcom80120181
bonitakayaking.comcom140120180
birantire.comcom90120180
binimuri.comcom80020180
beststarcoin.comcom120020180
bestpapel.comcom90120180
beratdekor.comcom100120180
bellsano.comcom80120180
beachvana.comcom90220180
barbarahost.comcom110120180
barakanatura.comcom120120180
bajafatih.comcom91220180
ayanhayvancilik.comcom150020180
avcifidan.comcom91120180
assentual.comcom90120180
artmabelle.comcom100120180
arenarosemere.comcom130120181
ardahansehir.comcom122820180
arablava.comcom801120181
angularcoarse.comcom130220180
andhraposter.comcom120120180
aliscontinental.comcom150120180
alexismar.comcom90120180
ahsapkano.comcom90020180
afyonpide.comcom90120180
cripplemask.comcom110020180
cointren.comcom811920180
bandouniversity.comcom150220180
shannonlimit.comcom120420090
sierraleonetalk.comcom1501120160
stoptornado.comcom110120180
nedensoma.comcom91120170
elmakart.netnet80020182
abattire.netnet80220170
abattire.comcom80320170
neonjade.netnet80020171
sadecedomainal.comcom140020170
nufusrandevu.comcom12451920170
hamiharmony.comcom110020170
civandeger.comcom100420170
parkchelyabinsk.comcom1581620170
bowlingbros.comcom110120170
bestmetalsale.comcom1317620170
mumbaitestsite.comcom1419406820170
mamadoru.comcom804820171
fotografburgas.comcom140520170
alfamadison.comcom111120170
seslisiparis.netnet120020171
sesliservis.netnet110020171
kareclear.netnet90120171
garciadeposada.netnet140020171
unikstop.comcom80020170
susurluktarim.comcom130120171
salesaplayer.comcom120120170
prestonobryan.comcom130720170
pascalculus.comcom110120170
panoramahavana.comcom140420170
ortaksatinalmak.comcom150120170
orgubebecik.comcom112120170
mutlukahvalti.comcom130120170
mobilyadolu.comcom110120170
maltaempire.comcom110120170
lindenatlas.comcom110120170
lagosuniversity.comcom1511220170
lagosmuseum.comcom117420170
lagoseconomy.comcom121220170
kurushita.comcom90220170
kulturenglish.comcom130020170
kayipkedikopek.comcom140120170
indiahim.comcom80120170
hulyaform.comcom902020171
hugosara.comcom8131320171
hanleymason.comcom1120120170
greenvalleymart.comcom15272020170
ganderamazon.comcom120120170
diclemekanik.comcom1204020170
diandianmama.comcom120120170
deryacoskun.comcom110120170
berebutan.comcom90120170
barristerball.comcom131420170
apakapak.comcom80120170
anitdent.comcom80220170
oaklandsyoga.comcom120120170
mysticmamabear.comcom140120170
mesemetal.comcom90120170
cimastation.comcom1112120170
bezgintavuk.comcom110220170
beachfirefilm.comcom130120170
hollywooddomino.netnet150020181
unioniste.comcom901020180
veresiye.netnet802620072
liftistanbul.netnet120020152
livabaski.comcom90120180
nigeriapark.comcom1101120170
lagospolice.comcom111220170
assensual.comcom91459241520180
guvenlikasa.netnet110120181
springtempo.comcom110320180
mantofani.comcom90120180
besiktaspost.comcom120120180
onurinan.comcom80120180
hacettepehukuk.comcom1401520180
definegaming.netnet120020181
purocostarica.comcom130120170
platformamazon.comcom140020180
hamikami.comcom80120180
patatesgonder.comcom1372420170
paradestin.comcom100120131
palobaca.comcom80220141
paladiamond.comcom110120180
oraclegrup.comcom100120160
oakislandmotel.comcom140120181
nordbuve.comcom82620110
nikbinkonak.comcom11113120160
nadideurun.comcom100120160
modernswift.comcom110120180
mirandaanda.comcom110120150
michaelkelek.comcom1201420080
metalmotel.comcom100720150
mayaince.comcom801120090
markkessel.comcom101720120
markarth.comcom80120150
malibubeachbeer.comcom150020150
linkrust.comcom802220110
leimertmarket.comcom130120160
lazerahsap.comcom100120180
kuzeyyaman.comcom100020130
kupluterminal.comcom13911420160
kilicerdem.comcom1001020120
keyfialemcerez.comcom14395120170
kaneinsaat.comcom100120050
hakankural.comcom100420170
golfguadeloupe.comcom140120150
globalmaiden.comcom120020160
ginacasey.comcom911020130
gilbertmartini.comcom145920120
garajstudyo.comcom1101020111
filmdini.comcom80120151
fiberperson.comcom110220130
federalmark.comcom1101520060
faikdanismanlik.comcom150220160
edwardsabatini.comcom1401220060
dohalens.comcom80120140
dinckuruyemis.comcom130120150
climaxgolf.comcom100220160
bullockbros.comcom1112820110
borabeauty.comcom100120161
boostika.comcom80520150
bonapartemart.comcom130620130
bonapartemarket.comcom150120130
bolgeseldiyet.comcom130520180
beerborn.comcom80420180
becharmusa.comcom100120150
bahisvideo.comcom1001020160
bacapalo.comcom80120141
astarmarket.comcom1102120181
artasiya.comcom80420150
argoshare.comcom90920092
arabianan.comcom90120160
amesguatemala.comcom130120150
frenchsiluet.comcom121502820150
rydelink.comcom80120170
planetveda.comcom100420160
eflatunspor.comcom1152820130
crystalrisk.comcom1101120160
minisimit.comcom90220180
miraclede.comcom942020140
adresmetre.comcom10761920080
bodrumfiber.comcom110220180
oymakinsaat.comcom1101420181
russianasl.comcom10351820180
ceyhandurum.comcom1102320170
katiekimball.netnet1201020181
terlanajans.comcom111171620150
ospreycovegolf.comcom140120180
universalcosmos.comcom1513320160
marksense.netnet9509973020152
sumberpoker.comcom113093820182
beijingglobal.netnet130220181
salonterry.comcom100220161
pondergram.comcom100120170
kusukart.comcom802520180
uniongrup.comcom9171520112
tuzsuzzeytin.netnet122313520181
yesilguvenlik.comcom130020150
dillonpark.netnet100020121
dumdumdumdum.netnet120220150
antakyatemizlik.comcom152603520150
maligora.comcom80220180
bagbagpark.comcom100520170
havasuparalegal.comcom150920130
guardaparaguas.comcom1411820130
halfwayfilm.comcom111892420141
yararsiz.comcom801020150
kotacirebon.comcom1101220152
thundermelon.comcom1201820180
dohamart.comcom803120150
hangisahaf.comcom106125420180
suyuperu.comcom80320180
ispartasaadet.comcom1381620160
ondogram.comcom80220181
hanafrank.comcom921320180
okuldosya.comcom921020180
muziktoptan.comcom1103820130
kayakballina.comcom12532220140
tazetatli.comcom90020181
ranamoda.comcom801420180
bahisdetay.comcom10596220161
filmagency.netnet1001620169
orijinalreyon.comcom130120180
almataam.comcom801020161
breakingbuddha.comcom140120180
esenyurttabela.comcom140120170
agriinsani.comcom1011020151
alissalina.comcom100120180
balkanmetal.comcom1121320170
biciaventura.comcom1233720004
dortyoltaksi.comcom120020180
modaliste.comcom901920140
salonsima.comcom90920140
belgiummail.comcom1111620141
dumdumdumdum.comcom1201920150
policenewyork.comcom130920180
kurbansatisyeri.comcom150920180
bilecikambar.comcom12121020181
guneskirtasiye.netnet1411620172
purelindsay.comcom1101320100
bestdealgolf.comcom12302820180
amillondrina.comcom1212220142
hurriyetotel.comcom120220140
evcilkedikopek.comcom1402520170
uniklassen.comcom105920121
fatihayaz.comcom90020060
ozgurnalbant.netnet1201020111
nigeriametro.comcom120920170
gorselhafiza.comcom120520150
ninekart.comcom80320180
sofiakim.comcom80320180
anadoluarena.comcom1201320160
bursamesin.comcom103694220160
lagosgarden.comcom110520171
unionmandarin.comcom1311620171
islamiskafors.comcom1311920120
basilegani.comcom10221920170
halkegitim.netnet10322020182
vidanovaagora.comcom130420183
bushpilotbowman.comcom1501320120
zekimiyim.comcom90120180
broadwayartist.comcom1481520160
xiangtanmama.comcom1212320170
uyumkursu.comcom92120081
southlakebikes.comcom14122120140
patriotpressure.comcom150820170
mavirenk.comcom803320180
santamariaperu.comcom1413320090
metahollywood.comcom1331420180
davetistanbul.comcom1394520150
essizfiyat.comcom1062720110
alyansmobilya.comcom1322720160
kayakingdallas.comcom14191420110
kalitelimakale.comcom1483320180
selcukgundem.comcom1201320150
vincitablet.comcom110220140
bornovagundem.comcom1305420150
trionsite.comcom9276520170
landespolitik.comcom1301020154
betonhala.comcom91781020111
knoxmodel.comcom901220100
muhtesemtarih.comcom130020140
angelsyoga.comcom100820161
bellnara.comcom801120140
legalcaptain.comcom120620140
simgeajans.comcom1001120160
recepdogramaci.comcom140320180
ozelderskayseri.comcom1501320170
unitedtireguam.comcom142520181
salihliyumurta.comcom1401220121
emirinsaat.netnet1041620183
lagossecurity.comcom130720170
kalemtasarim.comcom1202120170
kazakistanbul.comcom1301320180
triportor.comcom901820142
dentistinexeter.comcom1501520150
verimail.netnet801020179
pragmatik.netnet9011201831
corporatelink.netnet1301220188
vucutbakim.comcom1001020180
finostilo.comcom90220180
romanheroes.comcom1102720050
gastongazete.comcom1221920180
leadvalidate.comcom120320180
stephenandana.comcom130820130
evrevolt.comcom80720170
angelinamodel.comcom1301420130
urbanchina.netnet1002520098
apantaya.comcom81120180
hamarideal.comcom1004220170
landingpagesite.comcom1511420180
karenzpizza.comcom110120180
atlanticomail.comcom130220180
lidasite.comcom804020171
kristalmckenzie.comcom150520150
bikiniarena.comcom110220180
lovelyparfum.comcom12614720160
blissarama.comcom100320180
berlinpanorama.comcom1401320161
vakifbanka.comcom100020180
motorgene.comcom90120150
operanigeria.comcom120220170
failstop.comcom801320171
startreading.netnet1201020185
abhayasa.comcom80120170
banksharjah.comcom110820180
tayfunkaratas.comcom1312320150
chinatownlegal.comcom140120170
urbanvert.comcom90220181
jaliscocanta.comcom12242120100
teknikbahis.comcom110620180
aktueltasarim.comcom1314397920180
atilimpazarlama.comcom1594120100
mystichavanese.comcom1401020120
aracsergileme.comcom131220180
lakenova.comcom80520171
legrandsalon.netnet1202020187
speedwayvideo.netnet13484020182
fototeller.comcom10521820121
pricepolis.netnet100020040
burhankoyu.comcom10413620151
ozgunprefabrik.comcom14101420181
aktuelyorum.comcom110820160
sanalmenajer.comcom120720170
okyanuselektrik.comcom1501120131
enerjidijital.comcom13166420040
mangagothic.comcom1145220120
gazetesabun.comcom11285020150
pedalistanbul.comcom130120180
galaflora.comcom901220050
prestigy.comcom814520180
servanthart.comcom1121220080
sanalkuvvet.comcom1112520180
yigitmetalizmir.comcom1502020180
atamakina.comcom922620182
aciltazminat.comcom1246720180
paraguayharp.comcom1204320180
kartvideo.comcom992620040
zorlutemizlik.comcom13193420180
peruviandrama.comcom132929020180
namesurfers.comcom1101820161
bostonegitim.comcom12116120140
onderyapi.comcom91920162
bergromantik.comcom1201320031
dolmentours.comcom1101220161
empiremalta.comcom11199820170
portreunion.comcom1111520171
sigmakarma.comcom10241020180
kayakdelaware.comcom130720070
yesilderekoyu.comcom1316520180
ergingumrukleme.comcom15386020180
katalogavon.comcom1102820184
villarodrigues.comcom14162620170
globalnord.comcom100020181
philippepechard.comcom15157298620170
grupkoridor.comcom1142720180
afyoncanta.comcom1027420180
legalunited.comcom112351720081
vitrindergi.comcom11184120080
icelmersin.comcom1001120170
guzeypeyzaj.comcom11297320180
umutelektronik.comcom1431420182
locabilisim.comcom111611520180
zenginmetal.comcom113820180
forumdiyarbakir.comcom1501720142
vashonmail.comcom1035120030
davidlama.comcom9018220011
anadolukampus.comcom1302220090
martinrivers.comcom12497320030
namecrossing.comcom120520180
siirtkilim.comcom1066220080
pricepolis.comcom100920040
markabrand.comcom1002620170
ankarasimit.comcom1119713820120

Dün ve daha önceki günlerde düşen alan adlarını linkte bulabilirsiniz: Dün Düşen Domainler

Uzantı alan adlarını uzantı türüne göre bu bölümde görebilir ve tablo sıralamasını bu sütündan değiştirebilirsiniz. Eğer sadece COM uzantılı adresler ile ilgileniyorsanız aşağıdaki tabloda “Bul” kısmına “.COM” yazmanız halinde sadece bu uzantıya sahip adresleri görebilirsiniz. Sitemizde sadece önde gelen 3 uzantıya yer veriyoruz. Bu kısımda .NET ve .ORG uzantılarını da aynı yöntem ile listeleyebilirsiniz.

Uzunluk bu sütunda alan adlarını karakter sayısına göre küçükten büyüğe yada büyükten küçüğe doğru sıralandırabilirsiniz.

Backlink sayısı alan adının sahip olduğu toplam backlink sayısıdır. Maalesef internette düzgün çalışan API bulmak çok zor olduğu için bu verilerimiz güvenilir değildir. Eğer backlink değeri için alan adı alacaksanız lütfen kendiniz de adresi sorgulayınız. Tablomuzdaki veriler yüzde yüz doğru değildir bu sütunumuzda.

Archive sütununda adresin archive.org sitesinde yer alan kayıt sayısını görebilirsiniz. Domainin daha önce hangi kategorilerde ve aktif olarak yayın yapıp yapmadığına dair bu bölüm fikir vermektedir.

İlk Kayıt sütununda adresin bilinen en eski kayıt tarihi yer almaktadır. Domainin geçmişi için önemli bir kriterdir.

Toplam Kayıt sütununda ise com, net, org gibi kaç farklı uzantısının kayıtlı olduğunu görebilirsiniz.


Satılık Alan Adları

Haftanı popüler webmaster forumları ve domain platformlarında devam eden açık arttırmaları ve hemen al fiyatlı satışlarını aşağıdaki listemizde bulabilirsiniz.

Listemiz sürekli güncellenecektir, alan adları ile ilgileniyorsanız lütfen yazımızı hafta boyunca takip edin !

Açık arttırmada olan alan adlarının isimlerine tıklayarak satışın yapıldığı sayfaya gidebilirsiniz.

İlgilendiğiniz Adresler İçin Linteki Bağlantıdan Bize Ulaşabilirsiniz: Domain Satış

DomainKategoriFirmaKayıtBitiş
hiyeroglif.comJenerikNameBright20162020
kofa.netCVCVGodaddy19982020
sosyaluzman.comWebmasterNamebright20182020
sosyalasistan.comWebmasterIonos20192020
iletisim.orgGenelGodaddy20012020
kocaelihaber.orgHaberGodaddy20072020
etkinhaber.comHaberNamebright20072020
ressam.netGenelGodaddy20022020
beyler.netGenelGodaddy20002020
firmalar.orgE-TicaretGodaddy20062020
mp3indir.orgGenelGodaddy20032020
guzelseo.comWebmasterGodaddy20192020
ucretsiztema.comWebmasterNamebright20192020
seoscore.netWebmasterGodaddy20172020
adanaliyik.comGenelNamebright20152020
muhi.netCVCVHostingcomtr20192020
pezu.netCVCVNamesilo20192020
vohe.netCVCVHostingcomtr20192020
levu.netCVCVHostingcomtr20192020
kevu.netCVCVHostingcomtr20192020
luhi.netCVCVHostingcomtr20192020
gihu.netCVCVGodaddy20192021
pevu.netCVCVHostingcomtr20192020
gundem724.comHaberGodaddy20192020
mangir.netCoinHostgator20172019
zerzevat.netGenelGodaddy20112019
gorselarama.comGenelGodaddy20182019
gorselbilgi.comGenelGodaddy20192020
aranmahacmi.comWebmasterGodaddy20192020
ozgunyazi.comGenelGodaddy20192020
bagcilar.coİlçeGodaddy20192020
gaziosmanpasa.coİlçeGodaddy20192020
sariyer.coİlçeGodaddy20192020
kagithane.coİlçeGodaddy20192020
catalca.coİlçeGodaddy20192020
buyukcekmece.coİlçeGodaddy20192020
gungoren.coİlçeGodaddy20192020

Bu Bölümde Domain Listelemek İster Misiniz?

1 Domain Listeleme Aylık Sadece 1 TL ! Hemen Başvur

Alanadları, Forumlar Vb. Herhangi Bir Siteye Yönlenmeyen Alan Adları Kabul Edilmemektedir !