28 Haziran 2019 Cuma düşen domain (alan adı) listelerini yazımızın devamında bulabilirsiniz.

Domainlerin düşeceği gün, en geç saat 17.00-18.00 saat aralığında günün listesi sitemize eklenmektedir.

Facebook’ta Takip Et, Listeler Eklendikçe Haberin Olsun: https://www.facebook.com/isimyakala/


Domainler Ne Zaman Saat Kaçta Düşecekler?

Alan adıları yıllık olarak satın alınmaktadır ve eski sahipleri tarafından yenilenmediklerinde boşa düşerek tekrar satın alınabilir hale gelirler.

Farklı uzantılara sahip alan adlarının bugün akşam hangi saat araşığında düşeceğini linkteki yazımızda görebilirsiniz. En çok takip edilen .COM ve .NET uzantılar akşamları saat 20.30’dan sonra düşmeye başlamaktadır. Aşağıdaki listelerdeki alan adları bugün akşam düşecektir henüz düşmemiştir ! Detaylı bilgi için: Domainler Ne Zaman Boşa Düşer

28 Haziran Bugün Düşecek Alan Adları

Aşağıda kategorilere göre ayrılmış alan adlarının bir kısmını görebilirsiniz. Bugün sizler için seçtiğimiz alan adının tam listesini yazımızın alt bölümlerindeki tablomuzda görebilirsiniz.

Jenerik domain önerileri;

Jenerik alan adları bölümünde TDK Sözlük anlamlı düşecek alan adları listelenmektedir.

bahcesaray.net
bahsili.com
baliseyh.com
buyukorhan.com
catirti.com
devetabani.com
dogallik.info
dortyol.info
fermuar.org
gadir.org
gelgel.info
gercus.com
hentbolcu.org
isicam.net
izletmek.com
kambiyocu.com
kirkambar.org
kopek.info
lerze.info
musikisinas.com
musikisinas.net
pasci.org
radyofonik.com
rufeka.com
safha.org
sepetci.info
simal.net
stepne.net
tapulu.net
tartim.net
tutarsiz.com
ugurludag.com
vardiya.org
zibin.net

28 Haziran Düşecek Domainler Listesi

Aşağıdaki listedeki bul kısmına bilgi, sağlık, araba, haber, tekno, ekonomi, kadin, indir, tatil, emlak, bilet, kripto, sohbet, yemek, bebek, kitap, hediye, moda, oyun, sigorta, kredi, indir gibi kelimeleri yazarak sadece o kelimenin geçtiği alan adlarını görebilirsiniz.




DomainUzantıUzunlukBacklinkArchiveSon KayıtToplam Kayıt
blurayfilmindir.comcom15146720180
oyunali.comcom723520090
sohbeticanan.comcom127112720170
teknolojiherseyim.comcom17204674420070
vartohaber.comcom102813420180
periyotsigorta.comcom1401420090
yoninsaatemlak.comcom14302220180
kelime-oyunu.comcom1212220180
kadincabilgiler.comcom153082520181
tuesamemlak.comcom110120180
alfabilgiislem.comcom1443120160
oyun00.comcom643320140
gaziteknokent.comcom1301320130
hanememlak.comcom1012520170
kobikredi.comcom906320092
karamurselemlak.netnet1521420151
otekihaber.comcom1016420121
boksoyunlari.netnet1201120140
yeniyemektarifleri.netnet18102872420181
habercik.netnet845120122
lobisohbet.netnet102920180
indirimliucakbiletleri.comcom221371920181
neselisohbet.comcom12267420101
mimaremlak.netnet1002120181
cicekmagaza.comcom112165820150
sohbetline.comcom10562820170
forumuzmani.comcom111812920180
sigortaplaza.comcom1201920180
dumlupinaremlak.comcom150920170
teknostores.comcom110520180
egitimkredisi.comcom1301920110
teknolojiktarim.comcom150820170
tercihemlak.netnet1101020161
mandalinhaber.comcom131320180
kitapyakala.comcom110020180
seyahatbilgi.comcom120120181
sporhaberajansi.comcom1501720170
maynethaber.comcom1101120140
oyunturk.comcom82211820121
kitapfest.comcom951420180
arzhaber.comcom8289520130
tulayemlak.comcom1002220160
birdunyatatil.comcom130220181
yemekhesabi.comcom110120180
pdrkitap.comcom891220180
oyungunlugum.comcom1203220160
orenemlak.netnet90520170
gtgsigorta.comcom100020181
bebekkulisi.comcom111620140
parlakemlak.netnet110020181
telefondansohbet.netnet1624520187
veracruzmanufacturing.comcom21113720181
guarderiagarabatos.comcom18101820172
pilsanakuluaraba.comcom1601520181
ozaslaninsaatemlak.comcom180420160
demirogluinsaatemlak.comcom2003120150
forumuzmani.netnet110420180
karabakhinfo.netnet120020124
bodrumkiralikaraba.comcom1805520161
megemlak.comcom80020181
systeknoloji.netnet120020150
korkuteliemlakbankasi.comcom210020180
solanaguzman.comcom12123920140
hediyemuciti.comcom120020160
haberthy.comcom80220180
terastekno.comcom1023320180
habersitesiyazilimi.comcom1901620130
needforspeedindir.comcom1702720180
indirim-firsatlari.comcom180120180
hediyelikayna.comcom130020170
ailebebekuruttont2proudpremium.comcom300120140
altbilet.comcom801520180
askidahediye.comcom120720170
ayzelemlak.comcom100220180
bizdenhaberler.comcom1421820173
cadde-sigorta.comcom1301420120
evsemlak.comcom80020180
haberbuyaa.comcom100020130
hindirachnasansar.comcom1752020170
inkrediblysmart.comcom1502820150
kafteknoloji.comcom120120130
luksvillalardatatil.comcom190020140
nazlisigorta.comcom120020180
ayfaemlak.netnet90020160
egeemlakaydin.netnet130020161
aksuemlakatakent.comcom160020160
dizaynteknolojicozumleri.comcom240120160
pembedugunarabasi.comcom170420150
er-aysigorta.comcom120120160
redindirim.comcom100020180
yemekolay.comcom903220170
jiaoyunem.comcom92120180
parabarkod.comcom1044920180
haberlerss.comcom10152820170
bilgiceviri.comcom110020180
interhaber.netnet100320062
toptan-oyuncak.comcom140020180
332sigorta.comcom100020170
bebekuykumerkezi.comcom160120170
burcbilgileri.comcom130120170
iskocyahaber.comcom120120170
teknolojikmuhendis.comcom180120170
akayemlakantalya.comcom160220170
antemlakmoda.comcom120820170
tekinsoyemlak.comcom130120170
asveemlak.netnet90020171
isyapiemlak.netnet110020170
tubbioyuncak.comcom120120170
yapibilgimodeli.orgorg150020171
lugbilet.comcom80620171
teknondo.comcom80020170
teknolojikonsolu.comcom160720180
terpeneteknowledgy.comcom180120150
tikla-yemek.comcom110020150
ucuzarabaal.comcom110320110
habersitesiyazilimi.netnet190020130
sgemlak.comcom70120180
altanlaremlak.comcom130020180
arslanemlak07.comcom130020180
islamivillatatili.comcom170020180
saglik-ensonhaber.comcom170620180
bilgialp.comcom80020180
bilgiizleri.comcom110020180
dogahediyem.comcom110020180
elegantbilgisayar.comcom1701220180
kilincbebek.comcom110020180
makalehaberci.comcom130320180
mavemlak.comcom80020180
multimedyahaber.comcom150020180
traderhaber.comcom110020180
yapikredibank-tr.comcom160020180
haberizmirden.netnet136020181
arabahesabi.comcom110020180
arvestaemlak.comcom120020180
bekolsigorta.comcom120020180
bukadarolmazhaber.comcom170620180
calisbilgisayar.comcom150020180
corlukentinsaatemlak.comcom200020180
ebiletkolay.comcom110020180
eskisehirhaberajans.comcom190020180
hasna-indira-perkasa.comcom200020180
kocaeliucuzkitap.comcom160020180
reisemlakinsaat.comcom151820180
arabamkirada.netnet120020181
onlineemlakdanismanim.netnet210020180
turgemerkiletemlak.netnet180020181
haberinyeniyuzu.orgorg150020180
psikodiyetkitap.orgorg150020180
kriptotsentr.comcom120020180
iznikanadoluemlak.orgorg170020181
asukabebek.comcom100020180
bsukabebek.comcom100020180
csukabebek.comcom100020180
dsukabebek.comcom103020180
navadaucakbileti.comcom160020180
taoyunkun.comcom90020180
yapikredionlineislemlerim.orgorg250020180
asegesa.comcom7467520180
gakkom.comcom601020180
yilmazlarhurda.comcom14276120180
motorizm.comcom811320170
bayserteknik.comcom1212520080
cagriiletisim.comcom1316320180
evkurspot.comcom902320180
metalrafsistemleri.comcom180320180
plastikpaletler.comcom150120180
onbesliler.comcom100620150
tascioglutarim.comcom140720180
natacinsaat.comcom1101720170
eu-ko.comcom53894020181
cuptprop.comcom8238412320180
uskudar-haliyikama.comcom1821520181
cepphone.comcom802520172
dostturizm.comcom1032420100
onersaraciye.comcom124562520180
aloemeklilik.comcom1241020180
demiralmucevherat.comcom17727020160
joo-shop.comcom80220180
furkansaat.comcom1012020180
muzikaletlerim.comcom1422520170
5bir.comcom421720180
ujedi.comcom50520180
seslifinal.comcom1002120160
euro-ko.comcom742220180
altinsoygroup.comcom133720181
mcsmcan.comcom701320110
esepet.netnet602620183
naade.netnet5413520182
pachma.netnet6741820181
tartim.netnet6483691320182
monetaturkey.netnet12718520060
bmwgarage.netnet92222201814
akkayainsaat.netnet1275720053
silahtamircisi.netnet140220181
sacektirme.netnet1033120106
dogadostu.netnet9633220162
zsid.netnet41601720187
ankaramezaryapimi.netnet170920181
birlikgida.netnet102620172
yatasucbeyler.comcom1303020100
tonerpark.netnet99420174
havaifisekturkiye.comcom170020180
acilkepenkservisi.comcom170620180
pratikyasam.netnet110120181
susmakonus.comcom1022520180
ozenteknikmetal.comcom1572520100
avangardmotors.comcom140820182
mediadooh.comcom90220170
sedatucan.netnet9598520112
dolummakineleri.comcom1512020111
medyumzeynep.comcom1252220180
wirelessturk.comcom120520180
simetricephe.comcom120920160
beyzahaliyikama.netnet1511020171
masalyurt.comcom90120180
ankaraboyacisi.comcom1451820181
unyemsan.comcom80020180
berranikahsekeri.comcom16101420180
apexyazilim.comcom11102920180
kartuscity.comcom100120170
dunyaninmutfagi.comcom1502820180
hepspor.netnet7114820161
garantiajans.comcom1201520150
inciotel.comcom863520161
yusufparlak.netnet11711920111
anadoluyapiinsaat.comcom170920180
markastore.netnet1001520185
kalemler.netnet813120183
ulasplastik.comcom1114120130
abdurrahmanyilmaz.netnet171520171
printexcenter.comcom130220170
tonervitrini.comcom1201220170
sanzimancenter.comcom14182320120
emsajans.comcom80020180
euro-ko.netnet70820180
halilakcil.comcom10221520170
essaatlasmobilya.comcom160620180
reflexoloji.netnet1101220141
zorlutasarim.comcom120220180
modalanaliz.comcom110120180
maviyapidekorasyon.comcom1801220170
kaletadilat.comcom1101320180
kuryeyiz.comcom801820180
elissaguzellik.comcom140120180
lianamotors.comcom110320180
dekopratik.comcom1002420170
pendikkoltukyikama.netnet180420161
alternatifmatematik.comcom190120160
depremyonetmeligi.comcom170020180
gayrimenkulmerkezi.netnet180820182
chefajans.comcom90120160
cikolatasehri.netnet130020140
tekstilbaskimerkezi.comcom190120170
acilnakitpara.netnet1301320181
firtinadizayn.comcom1301120180
imamhatipokullari.comcom1701920120
karpetsan.comcom9136120100
kamgems.comcom7411720180
hitclup.comcom714020181
gifart.netnet62488420187
canvassan.comcom90020180
kelesoglugencgrup.comcom17234120110
hackerabi.comcom90920180
gokayahsap.comcom100820170
makaleportal.comcom120120170
sehrinaz.comcom80120180
evdenevefirmalar.netnet166987620141
isbankborcsorgulama.comcom19163020180
lokmaciniz.comcom101892320170
quantiferontesti.comcom1604020130
kubikuafor.comcom1033752620100
dogusmadencilik.comcom150920120
rehberamasya.comcom1202220170
aykuturas.comcom90620180
karaincikahve.comcom1321020160
lacosteturkey.comcom130620181
oztanyapi.comcom901820181
missarmoni.comcom100120160
hurdadepo.comcom90120170
724elektrik.comcom110120170
fotokopiborsasi.comcom150120170
tonersehri.comcom100520170
royaldugunsarayi.comcom164020180
biobosphorus.comcom1221120180
tonerpiyasasi.comcom130120170
kaletest.comcom811920170
nujs.netnet482082920187
clicktictac.comcom1152520170
hazerbeykoleji.comcom1472520140
tonerborsasi.comcom1224820170
artunoptik.comcom100020180
anadoludown.comcom110120160
sanalgrup.comcom902020180
armonigiyim.comcom110120160
edirnekutuphanetaksi.comcom2031820160
otogazantalya.comcom1302120160
aydemgrup.comcom90220180
yozgatcozumkoleji.comcom1744320140
alokasap.comcom801120070
alomanav.comcom801120070
ankaraogul.comcom102720150
bitkiselgidalar.comcom1501120100
bulutdunyasi.comcom120120120
dahafazlatermal.comcom150020120
degismedenyakala.comcom160120150
dmldizayn.comcom90020180
e2mutfak.comcom80120170
ekaremutfak.comcom110120170
emrekamcili.comcom110120150
ersahyapi.comcom90720181
erzurumkanalizasyon.comcom190520150
eveteslimorganik.comcom160120140
aselsanmetal.comcom1222520180
garantimax.comcom1001320150
geridonusumdeposu.comcom170120170
grandbeyazsaray.comcom150020180
hastanebulutu.comcom130120120
havalimanitransferdalaman.comcom250020180
ikizlerpetrol.comcom1301120181
imamhatipliseleri.comcom170120120
izmirkitabevi.comcom1382520120
kanyonyolu.comcom100020180
kirtasiyesitesi.comcom1501720180
kurssikayet.comcom110020120
marketkutusu.comcom1202420130
marketrafsistemleri.comcom1901620181
medyumyasemin.comcom1305620100
muhasebebulutu.comcom140120120
akdenizcocukparki.comcom1721020160
atomkarincaorg.comcom140120160
atomkarincaorganizasyon.comcom230120160
ballicaaricilik.comcom150120160
dinlemecihazifiyati.comcom191620160
elitpluskorfez.comcom140120160
gazianteppsikolojimerkezi.comcom250120160
inegolisiyalitim.comcom160120160
kopuzhaliyikama.comcom150320180
paydasalisveris.comcom150020160
pendikperdeyikama.comcom170920161
sayergayrimenkul.comcom160920160
sezginmantolama.comcom1501820160
sinopekahve.comcom110120160
trainingwithural.comcom160120160
yoncatvmedya.comcom1202820160
yummistic.comcom90120160
bonjourdergisi.netnet140020161
ekarar.netnet6191220161
golcuktemizlik.netnet1401220161
sporveiddaa.netnet110720160
oltabayrakimalati.comcom1702620120
onbeslilergidiyor.comcom170120150
ozkartuz.comcom81120180
mavierkekapart.comcom1401120180
sanliurfamagazin.comcom160220180
kurumsalarac.comcom120020180
renklikoli.comcom1001720170
savaskiran.comcom100720180
calismaiznibasvurusu.comcom200420180
unicornmt2.comcom100020180
transferbaskim.comcom140120170
sakindanismanlik.comcom1601120180
altiustumedya.comcom131920180
elazigkep.comcom94461420180
malatyacafeler.comcom1497545520180
qupha.comcom50520170
myratours.comcom92020180
hitclup.netnet70020181
xdrve.comcom5111620180
hayalimdekioto.comcom140020180
sivaslilarplastik.comcom170120171
otomobilodasi.comcom130020180
xsconferences.comcom130120170
royalkonut.comcom103020180
xdairy.comcom60520180
kambiyocu.comcom90020180
kariyertrakya.comcom130020180
xdyke.comcom50320180
bayiturkiye.netnet110020171
saygibilisim.comcom120020180
showkopyalama.comcom1301820170
antalyaalousta.comcom140120170
auerturkiye.comcom110120170
ayseveozan.comcom1001020170
bayiolmak.comcom90020170
bizimcirak.comcom100120170
canereklam.comcom10302220170
diyarbakirsaraytavan.comcom200220170
dskinsaatbilisim.comcom160120170
elazigotocikma.comcom1401020170
erdogankurt.comcom110020170
ferhanpeyzaj.comcom120120170
frigofrikborsasi.comcom160020170
frigofrikdunyasi.comcom160020170
geridonusumdepo.comcom150120170
geridonusumdukkani.comcom180120170
gladiusespor.comcom120720170
gozderehabilitasyon.comcom1901920170
herseyinspotu.comcom130120170
hurdatoplayicisi.comcom160120170
icerikportal.comcom120020170
icerikturkiye.comcom130020170
kadiryazlamaz.comcom130120171
kapaliband.comcom100120170
kariyeriskelesi.comcom150020170
kayserifutbolokulu.comcom180020170
kefligroups.comcom110220170
kelepirfotokopi.comcom150120170
kelepirtoner.comcom120120170
konyaperdetemizligi.comcom190120170
lastikcidayi.comcom121320170
lcselektron.comcom110220170
lifeprintcenter.comcom150120170
lifeprinteks.comcom120120170
meslekihayallerimiz.comcom19144920170
microsiszemin.comcom130720170
minamak.comcom70020170
mobilkiraliksahne.comcom1701720170
narfixcosmetic.comcom140120170
narfixmedikal.comcom130120170
nedjm-froid.comcom110420170
noirotshop.comcom100120171
olivegardenizmir.comcom160920170
onarimyeri.comcom100620170
ozasefc.comcom70020170
ozererdogan.comcom110120170
parla-brillare.comcom140120170
pergoletuzla.comcom120120170
platinconferences.comcom1701720170
printekscenter.comcom140120170
printlifecenter.comcom150120170
sarioglumermergranit.comcom200120170
semsiyetuzla.comcom120120170
siriusyonetim.comcom13102220170
sironaajans.comcom116320170
tipkininaynisi.comcom140120170
tonerithalat.comcom120120170
wolfkuchen.comcom100120170
yolcularotoekspertiz.comcom2001820170
bayilistesi.netnet110020170
cerkezkoyosb.netnet120020171
dekopratik.netnet100020170
kapakliosb.netnet100020172
makaleturkiye.netnet130020170
metrobimshop.netnet120020171
sahrahaliyikama.netnet150820173
yedekaldir.netnet100020171
tasitcenter.comcom110020180
hazirkartonpiyer.netnet160020141
teknikmuhendislikltd.comcom200020180
rafmodelleri.comcom120220180
piyono.comcom601020130
plajbayrakimalati.comcom1701720120
profiloservissincan.comcom190620120
sapkalikedi.comcom110520150
yagmurdagitim.comcom1301020100
yenibasimetiket.comcom150120120
zumrutesans.comcom1101220100
nizamevdenevenakliyat.netnet210020141
nizamnakliyat.netnet130020141
okeyoynar.netnet901020151
sapkalikedi.netnet110020150
1e1ofis.comcom70020180
2018depremyonetmeligi.comcom210020180
4birader.comcom80020180
abbaenerji.comcom100020180
adasumuhendislik.comcom160020180
afavrasya.comcom90020180
akyuzprefabrik.comcom140020180
anakomur.comcom80020180
ardamens.comcom80020180
avrupaninbuyukbedenmarkasi.comcom260020180
awpvale.comcom70020180
ayseozlemince.comcom130020180
bigonullu.comcom90020180
borekvebaklava.comcom140220180
bubenimotom.comcom110020180
burakstill.comcom100420180
buyukkoyhayvanciliktarim.comcom240020180
cafemilena.comcom100020180
cagriparkeyapi.comcom140120180
caphotographyart.comcom160220180
cekmekoyaktemizlik.comcom180020180
ceseglass.comcom90020180
chrstalmotors.comcom130020180
cpstakip.comcom80020180
csmekanik.comcom90720180
dogalsatinal.comcom120120180
ebruyildiztanis.comcom150020180
emsorganizasyon.comcom1559020180
enivagroup.comcom100020180
evdeanneokulu.comcom130020180
evisyeritadilat.comcom150020180
eyupsesi.comcom80020180
fikrimdesin.comcom110020180
fullalem.comcom80020180
gurpinarli.comcom100020180
hayalfest.comcom90020182
heybutik.comcom80020180
hisarlift.comcom90020180
hookafire.comcom90020180
hukukcularsitesipilates.comcom230020180
idealotomobil.comcom130020180
iftarvesahurvakti.comcom170020180
ilgibutik.comcom90020180
ilkkursunakademi.comcom160320180
internet-basvurusuyap.comcom210020180
intervipevdenevetasimacilik.comcom270420180
iskenderuncerceve.comcom170020180
kelebekyapimimarlik.comcom190020180
keopsw.comcom60020180
keriztv.comcom70020180
kibrisnakliyatevdeneve.comcom220420180
kiralikmakinam.comcom140020180
laramotors.comcom100020180
lgbtikolektif.comcom138020180
liontesbihcilik.comcom150420180
markacozum.comcom100020180
medikalalsancak.comcom150020181
milasozkanhafriyat.comcom180020180
minahaliyikama01.comcom160020180
msiizalasyon.comcom120020180
msiyapi.comcom70020180
msiyapikimyasallari.comcom190020180
mutlubircocuk.comcom130020180
mutluvetemiz.comcom120020180
nevnihalbakery.comcom140020180
nevnihalcafebistro.comcom180020180
nevnihalpastry.comcom140020180
nuhaydin.comcom80620180
orbisasansor.comcom120020180
orbismpt.comcom80020180
osmanarifsabah.comcom140020180
otobusculergelsin1.comcom1801120180
otoizolasyon.comcom120020180
ozcanaydnlatma.comcom140020180
pazaraltinoluk.comcom140020180
reshaconcept.comcom120020180
resimgunlugum.comcom130120180
sabanicenterpilates.comcom190020180
sadettingursu.comcom130020180
sanayimahallesipilates.comcom220020180
se-artmimarlik.comcom140020180
selectelectra.comcom130020180
seslimeryem.comcom110020180
seyrantepepilates.comcom170020180
solmazmangal.comcom120120180
sortekrobot.comcom110020180
stemxplay.comcom90020180
sumezepide.comcom100020180
surgunbahis.comcom110020180
tamserasansor.comcom130020180
tascioglutarimmarket.comcom200020180
tasdelenerkekpansiyonu.comcom220020180
tasitroom.comcom90020180
tasittrend.comcom100020180
tbrosur.comcom70020180
tfystech.comcom80020180
trakyaasansor.comcom130020180
tshirtyaptir.comcom120020180
turcaspacer.comcom1115020180
turkiyeninbuyukbedenmarkasi.comcom270020180
turkiyeningencbuyukbedenmarkasi.comcom310020180
ustagul.comcom70020180
uygunasor.comcom90220180
victoriasecretoutllet.comcom210020180
worldarchitectscouncil.comcom220020180
yapigunleriduzce.comcom160020180
zeytinilicasikaplicalari.comcom240020180
zorluartcraft.comcom130020180
zorluclub.comcom90020180
zorludigital.comcom120020180
zorlukodlama.comcom120020180
zorlumaker.comcom100020180
zorlumaket.comcom100020180
zorlumodel.comcom100020180
zorlurobotik.comcom120020180
2018depremyonetmeligi.netnet210020180
abazlaret.netnet90020181
biemhukuk.netnet90020181
depremyonetmeligi.netnet170020180
gebzekupaplaket.netnet150020180
joo-shop.netnet80020180
modalanaliz.netnet110020180
nevnihalbakery.netnet140020180
nevnihalcafebistro.netnet180020180
nevnihalpastry.netnet140020180
tebessumspa.netnet110020180
tellimakina.netnet110020181
4leventaletlipilates.netnet200020181
cereaymerdiven.netnet1416120181
kocaklaravm.netnet110020181
konikboru.netnet90020182
possafe.netnet70020184
proguc.netnet60020181
rizeviptransfer.netnet150020181
tubaotopark.comcom1131920170
reflexmoda.comcom101720180
citroencikma.comcom120920180
ozanevren.comcom9664020071
ankaradaevdenevetasimacilik.comcom278617020180
imcfilm.comcom70020151
evdeneveankaranakliyatci.comcom249229420180
olionews.comcom8925420180
adapirlanta.comcom1101520170
sanatterapi.comcom110520171
evdeneveankaranakliyatfirmasi.comcom298896120180
yapiyasam.comcom90120142
yapiveyasam.comcom110020141
evdenevenakliyattankara.comcom233691520180
filmece.comcom722720150
mixbutik.comcom801320170
hasereilaclamaantalya.comcom21492820140
istanbultadilatdekor.comcom201842520150
butikdefne.comcom100020180
corludahaliyikama.comcom170020180
redlinegold.comcom110020160
oturma-izni.comcom1102520170
teraryumcular.comcom130020180
tekmoda.netnet70020182
tekmodam.comcom80020180
ahrenogullari.comcom1338220170
boy-aynasi.comcom100020170
cmdvrm.comcom64120170
cocuklarlasanatterapi.comcom210020170
dr-yusufmahmut.comcom1403320170
drkemalunal.comcom110120170
hdfilmizlebaba.comcom1401420170
ikaanyilmaz.comcom110120170
ikamet-izni.comcom110420170
ikametizini.comcom110020170
kamiletturizm.comcom131120170
kapi-susleri.comcom120020170
ledtabelamalzemesi.comcom1864120170
mevadokum.comcom90920170
pleksi-ayna.comcom110020170
plexi-ayna.comcom100020170
sanatterapicocuk.comcom160020170
stajyersoruyor.comcom142506820170
ikaanyilmaz.netnet110020170
ikadanismanlik.netnet146020171
osmanlitercume.netnet140520171
oturmaizini.netnet110020171
radyoasikane.comcom12591320131
5duyuanadolulisesi.comcom180020180
5duyuegitimkurumlari.comcom200020180
5duyufenlisesi.comcom140020180
5duyuokullari.comcom130020180
akcaybayrak.comcom110020180
archantares.comcom110020180
arvestagayrimenkul.comcom180020180
besduyuanadolulisesi.comcom200020180
besduyuegitimkurumlari.comcom220020180
besduyufenlisesi.comcom160020180
besduyukoleji.comcom130020180
besduyuokullari.comcom150020180
encuzifiyat.comcom110020180
gungorenhaliyikamafabrikasi.comcom270020180
hamadaaligroup.comcom140020180
kalafatsolucan.comcom140020180
larapsikoterapi.comcom150020180
moyamoduler.comcom110020180
muhammedb.comcom90020180
nakliyattankara.comcom15330620180
simkarotomotiv.comcom140020180
sutlukdunyasi.comcom130920180
ucuzakedikumu.comcom130020180
yusmer.comcom60020180
artesdanismanlik.netnet160020182
serdarguven.netnet110020181
ervaesarp.comcom941220150
davetiyekartvizit.comcom1711520180
sitenisat.comcom921020180
tirtilim.comcom82420180
ozturkbulent.comcom1201620170
burdurilan.comcom1004020150
doganayelektrik.comcom151220180
biberogluayakkabi.comcom1714120061
miraydekor.comcom1061120060
turkiyedefutbol.comcom15243920180
rosemarquetry.comcom1302620130
cagdaskagitcilik.comcom160920140
mezarrestore.comcom1201120180
e-anaokulu.comcom1002920180
devproje.netnet8414320182
ekartvizit.netnet1002020181
giyimnoktasi.comcom1202520170
zamantisulama.comcom13524020100
bahcekapisi.netnet1124420102
fabrikakapisi.comcom1302620100
atlasrulman.comcom1101420101
nerdebeles.comcom100520101
egzosemisyon.comcom120020180
caddem.netnet613020171
telrehberi.comcom100320180
ozenerpatent.comcom120620161
doktordevrim.comcom120520170
tuzlayasam.comcom100520180
daiwaturkiye.comcom120320180
enuygunpc.comcom90820180
odevcenter.comcom100620180
cigkoftebank.comcom120020140
calgilimeyhane.comcom1401820180
ulgertur.comcom801420160
brodedesen.comcom1001320180
adresbursa.comcom1001620180
sagliklipazar.comcom130820170
organikbitki.comcom122820180
altinceviz.comcom100920180
multiplexgames.comcom141172020130
primist.netnet70020132
blksr.comcom502020180
yoreselkiyafet.comcom1404120140
kayraconcept.comcom120020180
projeguvenlik.comcom1301520180
ruhiodev.comcom85903120160
istanbultesisatcim.comcom1895620110
azemet.comcom601720180
altintepeambalaj.comcom1665020110
marbleofchina.comcom130020180
selvim.comcom60620150
karakayatarti.comcom1342520180
tuzlakentrehberi.comcom165920180
firma365.comcom841620174
hobiparki.comcom90320180
rekalastik.comcom100520140
sacekimiyapimi.comcom1421520180
dmtsys.comcom601120130
karelsantraldestek.comcom180120180
marmaristransfercompany.comcom2373720120
myturkeycenter.comcom141278420120
gizempolat.comcom1001220170
neoturkiye.comcom100720180
timemaltepe.comcom1101820170
panelsepeti.comcom1101320170
adworksplus.comcom110420180
selvigiyim.comcom100020150
zamanci.comcom70620180
firinmarketi.comcom123484820180
eryamanspot.comcom1101120170
sosyetepilavcisi.comcom160220150
ureticiburada.comcom130120172
ebrulitemizlik.comcom140120170
fensaat.comcom733020180
samilozdemir.comcom1241220170
konferanskoltuguimalati.comcom2312320180
nenedirnedemekhakkindakimdirbiyografi.comcom370520180
archivearchitecture.comcom194920180
bonusled.comcom864320130
gokturkdoner.comcom1211720170
hermarket.netnet90120162
zirkonyumimplantdis.comcom190520180
kranex.netnet60220186
tarfanlarorganik.comcom1611320160
kartoncantafiyat.comcom1601920130
ereglievdenevetasimacilik.comcom2541220140
htmmuhendislik.comcom1411020180
findallshops.comcom120020181
retinabursa.comcom110120170
celikgonen.comcom1002120130
arsdecors.comcom912820140
unlockstore.netnet1102220129
hamuranne.comcom90020170
fatihhavalimani.comcom150020180
polatinsaatgayrimenkul.comcom220020181
rukusfasil.comcom10131020140
decortr.comcom701320180
whitebeachcafe.comcom140120180
kumaskapliakustikpanel.comcom220020180
kumaskapliakustikpanel.netnet220020180
moulinmac.comcom90220160
tarhanaliturizm.comcom151920161
baharbobinaj.comcom120020180
adraet.comcom611720160
ciftciogluinsaat.netnet1611120162
anilmedikal.comcom110920181
modernrehinciler.comcom160420180
asyakentseldonusum.comcom1846820130
asyamutfakbanyo.comcom150020170
babyyesim.comcom90020140
bizimleevlenin.comcom1401520130
kelilevedimne.comcom130120170
bodrumtransfercompany.comcom2103020120
bronzten.comcom801220100
celebidemir.comcom110220180
ciglimedikal.comcom120020180
deryaxml.comcom80020130
esastemizlik.comcom120020180
esnaftarifesi.comcom130020170
fitodora.comcom801120180
giesto.comcom624420170
gulnurgeris.comcom1102120100
terracesuitotel.comcom15204820160
hbmotorluaraclar.comcom160120140
hulyadogan.comcom1004820110
kurumsalseshizmeti.comcom1825520160
justhomebaked.comcom130120150
kotanciahsap.comcom120620180
koydenkapiniza.comcom141120170
mavihost.comcom85723020182
modaselvi.comcom90020152
nalburstore.comcom1101020180
alisverisguvende.comcom160520160
cerenilyasoglu.comcom140420160
denizlikadirtekstil.comcom1901420160
depodabuldum.comcom120020160
e5avm.comcom50020160
endustri40plus.comcom140120160
endustri40tr.comcom120120160
findiklokum.comcom110020160
haliyikamacanakkale.comcom19492320160
ibanme.comcom60120160
koxiderm.comcom80020160
koxidermturkiye.comcom150020160
pastasef.comcom80020160
samsunkuzeyotomotiv.comcom190020160
unutkananneler.comcom141413020160
yeninesilparti.comcom140020160
yeninesilpartisi.comcom160020160
zeniplik.comcom821420160
omergokalp.comcom1002020170
onlineciceksistemi.comcom1803720130
paragibi.comcom80120140
cloudalone.comcom100020180
asenerji.netnet80320182
akustikahsapkaplama.netnet190020180
taxi34.comcom60820182
gurcamlimited.netnet1312220121
misspide.comcom80020181
promosyoncaddesi.comcom160420170
randuman.comcom80020180
kayseritakograf.comcom150020180
neyersin.netnet80320181
havrannakliyeciler.comcom180120180
clawsafe.comcom801220180
senetworking.comcom120020180
2acimedical.comcom110220170
724parti.comcom80120170
active-dry.comcom100520172
alteksogutma.comcom1201120170
anahtarteslimisera.comcom180120170
arslanitriyat.comcom130020170
asoszeytincilik.comcom150020170
assoszeytincilk.comcom150020170
basaksehirnakliyatevdeneve.comcom260120170
ducolora.comcom80020170
ereneturk.comcom90120171
goldsunbayi.comcom110120170
goldsunfiyat.comcom120320170
guvenlist.comcom901720170
igaled.comcom60020170
istanbulhakimlik.comcom160120170
istanbuloto-ekspertiz.comcom210020170
kabulpatent.comcom110120170
kanyonetiket.comcom120020170
livagayrimenkuldanismanlik.comcom260120171
oto-ekspertiz-istanbul.comcom220020170
petlobi.comcom70320170
promareel.comcom90020171
rotalezzet.comcom100120170
saraccevre.comcom10316820170
servis-merkezimiz.comcom176120170
sevillaendustriyel.comcom180020170
simetriarackaplama.comcom180020170
slaturkiye.comcom100220170
sogukzincirlesutkapida.comcom220020170
surecdenetimi.comcom130020170
trtworldacademy.comcom150020170
unlupinarkurs.comcom130120170
workshoppres.comcom120020170
yogiliyoga.comcom100020170
fikirmahsulleriofisi.netnet200020171
kabulpatent.netnet110020170
remziavci.netnet90020171
rabiaakkus.comcom100220130
tedarikkulvar.comcom1301320180
tatliballi.comcom100320180
rosemarkuteri.comcom1301920130
samsunendustriyelkapi.comcom210020140
samsunotomatikbariyer.comcom210020140
samsunotomatikpanjur.comcom200020140
selvibutik.comcom100020152
selvimmoda.comcom100020150
selvimoda.comcom90020150
selvimtesettur.comcom140020150
sevitkoyu.comcom90820130
teknikbezler.comcom120120140
threepepper.comcom1101120060
toroid-core.comcom1101020100
ulukislaotokurtarici.comcom200920150
cihangirbalikcisi.netnet170020141
justhomebaked.netnet130020150
pozantiotokurtarici.netnet190120151
ulukislaotokurtarici.netnet200020150
urunsokagi.comcom100320180
boyarsanplastikboya.comcom190020180
crossfitanatolia.comcom160020180
cyosdigital.comcom110020180
kobi360danismanlik.comcom180020180
moringacayresmisite.comcom190020180
portoreklam.comcom110620180
sup360danismanlik.comcom170020180
turanyapiordu.comcom130020180
veblise.comcom70020180
adanamasajkursu.comcom150020180
agdgenclikbulusmasi.comcom19118020180
ahsapakustikkaplama.comcom190020180
airpetnb.comcom80020180
akrayapicephe.comcom130020180
aksemsettinhavaalani.comcom200020180
aksemsettinhavalimani.comcom210020180
alihalleder.comcom110020180
ankaramegatemizlikhizmetleri.comcom280020180
antepliahmetbabasofrasi.comcom230020180
archiveistanbul.comcom150020180
armonidugunsarayi.comcom170020180
arsivistanbul.comcom130020180
arsivmimarlik.comcom130020180
arzihayalturban.comcom150020180
asistcrane.comcom100020180
asisthair.comcom90020180
asistmakine.comcom110020180
asistvinc.comcom90020180
atacamayna.comcom100020180
ataturktarihi.comcom130020180
atilimgymmugla.comcom140020180
avtohesabi.comcom100020180
aydinciklilardernegi.comcom200720180
aygunkaracibioglu.comcom170020180
aytgaming.comcom90020180
bakimmodernizasyon.comcom180020180
ballitatli.comcom100020180
barkotomotiv.comcom120720180
bay-call.comcom80020180
beylikduzusporsalonum.comcom211358621320180
bicaygetir.comcom100020180
bilgearidilokulu.comcom160120180
biocomrd.comcom80020180
birkenstockterlikleri.comcom210020180
bitabakcini.comcom110020180
bitcoinbalina.comcom130020180
bogazicitour.comcom120020180
btcbalina.comcom90020181
cephesabi.comcom90020180
cibhesabi.comcom90020180
cirquitosdeturquia.comcom180020180
cirquitosenturquia.comcom180020180
conradhukuk.comcom110020180
cumhuriyethavaalani.comcom190020180
cumhuriyethavalimani.comcom200020180
dahiatolye.comcom100020180
daisyhomecollection.comcom190020180
dbakustik.comcom90020181
designsoftourism.comcom160020180
digiyatirim.comcom110020180
dijitalbagimlilik.comcom170020180
disetivegulusestetigi.comcom210020180
dnsbizim.comcom80120180
ecrinbakim.comcom100020180
efronistatistik.comcom150020180
eirsaliyekolay.comcom140020180
elektronik-otomasyon.comcom200020180
epttvisa.comcom80020180
epttvize.comcom80020180
fantazispray.comcom120020180
fatihhavaalani.comcom140020180
filmizledot.comcom110020180
fsgruptemizlik.comcom142020180
gazzekabab.comcom100020180
gazzekabap.comcom100020180
gazzekebab.comcom100020180
gazzekebap.comcom100020180
gestolift.comcom90020180
hasaltecrubenipaylas.comcom200020180
hasanalekber.comcom120020180
havaliistanbul.comcom140020180
havalikafe.comcom100020180
havaliorganizasyon.comcom180020180
hgisivas.comcom80020180
instabesa.comcom90020180
internetkoin.comcom120020180
ironreklamcilik.comcom150020180
irsaliyekolay.comcom130020180
iscihesabi.comcom100020180
ishcihesabi.comcom110020180
ispartagulfestivali.comcom190020180
isteliderler.comcom120020180
isteliderlerplatformu.comcom210020180
isteliderlerzirvesi.comcom190020180
ivedikkart.comcom100020180
izmircesurlokma.comcom153320180
izpolsan.comcom80020180
kababgazze.comcom100020180
kabapgazze.comcom100020180
kaentesisat.comcom110020180
karadenizmermerci.comcom170020180
kebabgazze.comcom100020180
kebapgazze.comcom100020180
kofenasansor.comcom120020180
koinkesesi.comcom100020180
koinsaati.comcom90020180
korfezrulocim.comcom130020180
korkumetin2.comcom110020180
kumasduvarpanelleri.comcom190020180
kumaskapliakustikkaplama.comcom240020180
lilybutika.comcom100020180
lostmotorcycle.comcom140020180
manuelsacekimiyapimi.comcom200020180
marbleexpertchina.comcom170020180
markakur.comcom80020180
matriks-muhasebe.comcom160020180
matrix-muhasebe.comcom150020180
mb-medikal.comcom100020181
mebateknikservis.comcom160020180
mechanicgaragetr.comcom160020180
mehmetdogandemir.comcom160020180
metalpusula.comcom110020180
metehanozkun.comcom120020180
mulksatan.comcom90020180
natureestetik.comcom130020180
neoidturkey.comcom110020180
neyersun.comcom80020180
onurtentebodrum.comcom152020180
otdbilisim.comcom100020180
ozcanotomotivdanismanlikhiz.comcom270020180
ozlemkaaninteriors.comcom180020180
periskele.comcom90020180
pttdenizde.comcom100020180
pttvisa.comcom70020180
pttvize.comcom70020180
resimliduskabin.comcom150020180
rukiyekayabasi.comcom1464020180
s-on2kardiyoyagyakimi.comcom2101220180
samnimo.comcom70020180
sarikayahome.comcom121020180
satelektronik.comcom130020181
selcukluhamam.comcom1322520180
sinem-yurtseven.comcom150020180
sirribasari.comcom110020181
smyrnapetrol.comcom120020180
snrhayvancilik.comcom140020180
studiotuo.comcom90020180
tartialetimuayene.comcom170020180
tartialetimuhurleme.comcom190020180
tctagro.comcom70020180
trabzondavilla.comcom140020180
turkiyedortsifir.comcom160020180
turkundestani.comcom130020180
viphdpro.comcom80520182
vivabeting.comcom100320180
zaralazerepilasyon.comcom180020180
zekamotoru.comcom100020180
ahsapakustikkaplama.netnet190020180
asenergo.netnet80020182
bicaysoyle.netnet100020181
bonjourcoiffeur.netnet150020181
cloudalone.netnet100020180
cocukkralligi.netnet130020180
coiffeurbonjour.netnet150020181
dbakustik.netnet90020181
depantolin.netnet100020181
elektrikliulasimaraclari.netnet240020181
eyoniletisim.netnet120020180
komri.netnet50020181
kumasduvarpanelleri.netnet190020180
kumaskapliakustikkaplama.netnet240020180
satelektronik.netnet130020181
ssnaturalfit.netnet120520181
tmgddanismanligi.netnet160020181
tripomen.netnet80020181
ebruseker.netnet90020181
atesiniyollabana.comcom16010120090
hulyagiyim.comcom1021920060
hadisiserif.comcom11706520052
patentdanismani.comcom1552120160
atinaotelleri.comcom1301320160
organikcenneti.comcom140820180
e-demo.netnet6071201813
dspor.netnet50720182
cuppers.netnet702201212
lazerepilasyonmerkezi.orgorg2102520182
metaf.orgorg5012200811
metinn.netnet62414120101
buradaoku.comcom90020180
hepsiantalyada.comcom140120140
vipdomain.netnet918201117
bestturkiye.comcom110620180
milenyumasansor.comcom1512720131
mersinidmanyurdu.netnet16234320105
mavipapatya.comcom110620180
tuzlacicek.orgorg10151820142
ikincibolge.netnet111310513820131
dekokent.comcom831020170
melekleranaokulu.comcom16153920160
cavusogluuludag.comcom1503020180
yunanistanotelleri.netnet180620161
debkatime.comcom9167920120
ckrender.comcom80020180
mavikapak.netnet90320181
patentfirmasi.comcom1301420160
lezzetkapimda.netnet130120141
girisimcirehberi.comcom1601320081
sacekimiturkey.orgorg140620181
patentfiyati.comcom1201120160
newpropertiesglobal.comcom190620160
besturkiye.comcom100020180
barastar.comcom80120181
sosyologlar.netnet11166720112
adaloftaparts.comcom1373720130
ithaldusakabin.comcom140020150
dusakabinsepeti.comcom150020152
atacicek.comcom815452020070
karabeyvinc.comcom110220170
yazcalistir.comcom110520170
cocukdiyetisyeni.comcom160020160
zileozenis.comcom1081020140
cayirovacicekci.orgorg151420141
funtorya.orgorg80920120
tikayder.orgorg81920130
akatkozmetik.comcom1214220022
brickulubu.comcom1001120101
camlik42.comcom82620120
degermutfak.comcom110120120
demiryd.comcom703820130
emeasecurityconference.comcom220120130
flexyofis.comcom90020170
haftasonurafting.comcom160120120
issaturkeyconference.comcom200020130
kayapalazzootel.comcom150020120
kibrisotelleriniz.comcom170620120
mesaechafaudage.comcom150120110
mustafatemur.comcom1202120140
alo-yurtdisiborclanmasi.comcom230220160
camsiperaynasi.comcom140020160
elyabicak.comcom90020160
kilitlivantuzluayna.comcom190020160
kivakilitlivantuz.comcom170020160
kivavantuz.comcom100020160
krommarinyatmalzemeleri.comcom2321420161
lavaahsap.comcom90220160
motaynasi.comcom90020160
motosikletsiperaynasi.comcom210020160
onlinepatental.comcom141720160
tozsuzparkemakinasi.comcom190020160
onlinetransferantalya.comcom210220130
onlinetransferbursa.comcom190120130
onlinetransferistanbul.comcom220020130
onlinetransferturkey.comcom200220130
onlinetransferyalova.comcom200020130
orsadogalgaz.comcom120220130
loccacafe.netnet90220181
tiosm.comcom50020180
shaiyafinal.comcom1102920150
ajansambalaj.comcom120020170
15temmuzsehitmustafakocakasm.comcom2821020170
drvolkansaykol.comcom140120170
dteccoating.comcom110220170
ferhatmak.comcom92920170
haticeoktemkilicaslan.comcom210320170
indemayapi.comcom100020170
koklusuitotel.comcom130920170
maregocce.comcom921720170
mavigolddugunsalonlari.comcom220020170
nuraysavas.comcom100220170
cubuk2noluasm.netnet13272520172
hanoil.netnet60020171
hanoil.orgorg60020171
durmazyazilim.netnet130020132
ipekhanimciftligi.netnet170020121
1evimolsun.comcom100120180
aegeancast.comcom100520180
alperotoyedekparca.comcom18402120180
arkjeoteknik.comcom120020180
aybsolarenerji.comcom140020180
banaanimasyon.comcom130020180
bercestekahveevi.comcom160020180
borobilimsanatokullari.comcom220020180
borokoleji.comcom100020180
enmodabikini.comcom120020180
enmodaetek.comcom100020180
enmodakostum.comcom120020180
eryapiyonetim.comcom130020180
gagalar.comcom70020180
haliyikamavatan.comcom152120180
hochzeitskonzept.comcom162320182
istanbulfoodgawker.comcom180020180
itemcii.comcom70220180
kaskomixo.comcom90020180
loccacafeakbuk.comcom140020180
loccacafedidim.comcom140020180
mavibilyeyayinlari.comcom184420180
mavigoruntuleme.comcom150020180
maviicerik.comcom100020180
maviyayinlar.comcom120020180
mdyapimarket.comcom120020180
medibrows.comcom90020180
nesillawfirm.comcom120020180
papatyaorganik.comcom140020180
paramixo.comcom80020180
salisacademy.comcom120020180
scootertr.comcom90020180
sigmamaket.comcom100020180
sigmamodelmaket.comcom150020180
tesisyenileme.comcom130020180
tesmob.comcom60120180
topsofturkey.comcom120020180
unnaturalgenetics.comcom171020180
yuklenentl.comcom100020180
hdserveriptv.netnet120020181
sespaketi.netnet90020181
bahceniz.orgorg80020180
abdulhamiddusuncedernegi.orgorg240020180
bimakale.orgorg80620182
iklimfinansmani.orgorg150020180
nevaepilasyon.orgorg130020180
nevalazerepilasyon.orgorg180020180
sacekimimturkey.orgorg150020180
gazaltikaynakteli.netnet170720171
instabegenitakipci.comcom181220160
sg2kaynakteli.comcom130920170
sg3kaynakteli.comcom130120170
sbsanahtar.comcom1021720070
arsklima.comcom831320180
akaypeyzaj.comcom1071020120
netendustriyelsogutma.comcom210420180
kartoy.comcom611120120
netagumrukleme.comcom140120130
yagmurtanelerianaokulu.comcom223720180
cannonstar.comcom10685620040
modelgina.comcom9176520180
startlatvia.comcom114212020070
turkcehit.comcom901820180
videosfat.comcom928672020180
bizimtayfa.comcom1023320161
estellepark.comcom1101920030
giresunnakliyat.comcom15905620092
studiofoto.comcom10591141200324
fotolumen.comcom91067320181
barakaya.comcom8255420181
daleperu.comcom802220182
bankherald.comcom10101620180
akasyatemizlik.comcom144919020181
meritkimya.comcom1021920150
gagastory.comcom933620020
anadolukaynak.comcom130620182
borareklam.comcom10205120170
markainsaat.comcom110720091
eylulkozmetik.comcom1301020181
lakestreetmedia.comcom1583820130
seribaja.comcom811920150
cicekdizayn.comcom1101520180
gizligece.comcom902220180
tanitimfilm.comcom1101520080
onderseracilik.comcom1443120181
firathaliyikama.comcom1501620081
linkkazan.comcom90820180
programyeri.comcom111334420180
alacatimagazin.comcom14233895220180
seslimetro.comcom10185020180
ekstremspor.comcom1102820170
chinarendering.comcom1434620170
yedincicadde.comcom1204020171
strangetek.comcom10131020170
isinmuhendislik.comcom1502620141
brainerdlegal.comcom13102620080
albumstamping.comcom1329520040
oteldikmen.comcom101320160
linkbanks.comcom936520180
kentdanismanlik.comcom1501020160
turkeypanel.comcom110620180
ayazsesli.comcom901220180
volkansisman.comcom1201020180
robertsmartin.comcom1302220130
bearmania.netnet977611720185
istanbulgelisim.netnet15109120181
zibin.netnet5946201815
kosamusa.comcom801720180
partnerilan.netnet11356620161
simal.netnet5050201825
fermuar.orgorg712420168
purefrancis.orgorg113823020160
imargaza.orgorg88113920090
safha.orgorg5230201810
gadir.orgorg522420189
polisagora.comcom10120313120180
tamaracpark.comcom110720160
harlanforum.netnet119516020101
brandnamehome.comcom130720170
addismart.comcom90920140
bogazkoy.orgorg832620174
bakirkoysinav.comcom1324620180
genclikforum.comcom1210577020140
abacination.comcom110320181
metropolhayat.comcom13206720100
lapazvilla.comcom1001420100
kayipcennet.comcom1103520130
amberplum.comcom91920150
golflanding.comcom110920180
uygunpazar.netnet1031720112
ameslakehome.comcom120220180
vardiya.orgorg701320183
budapoker.comcom901120181
protonmalaysia.comcom1401720181
bebefine.comcom80020180
sistempoker.comcom110020181
nashvillestart.comcom1401020130
dekorasyonmoda.comcom1452120100
devetabani.comcom1002020120
basketbest.comcom100920170
atlasguvenlik.comcom13108420181
museumglobal.comcom1201620160
selcukdemirci.comcom1302120162
normmacleod.comcom110920120
evremail.comcom80320180
radyofonik.comcom10141120180
articlio.comcom801520180
baharcenter.comcom111520181
holidayplan.netnet11035201722
parkhawaii.comcom10161620160
hawaiimarina.comcom121771820160
robotsocial.orgorg110020183
kocamese.comcom81420132
chinaalarm.netnet100520181
palmfestival.comcom123520180
vitaminforum.comcom1204520035
maviekol.comcom8435520180
karismedia.comcom10305820160
tapulu.netnet611220181
stajburada.comcom1001520140
noidamail.comcom90620160
islamfedaileri.comcom14101920140
izletmek.comcom801820180
atlaspark.netnet911920155
surprisegolf.comcom1201620180
gotoprinter.comcom1101220180
sealform.comcom801720120
mercankozmetik.comcom140220180
arcadearena.netnet11686920184
salougolf.comcom903520070
albalala.comcom81742420180
peristop.comcom8131120173
trenstop.comcom82420180
tibethome.orgorg90320182
biciplanet.comcom1001520124
arenaleague.netnet115975320171
manuelarmstrong.comcom1545020101
firatkizilay.comcom1252820180
riskbeacon.comcom1001420181
looplala.comcom801520180
ethiopiakarate.comcom14342620180
waynesite.comcom901020160
manavadi.comcom80920180
kirkambar.orgorg9311720172
mavipudra.comcom901820180
vashonsalon.comcom1121520130
diyaryapi.comcom92920180
dizirenk.comcom815620170
hollandfilm.comcom1103520042
rinconadastore.comcom1411720170
yogawinner.comcom100820180
afyonterazi.comcom11103320110
fenerbahcekart.comcom1401020150
amberburnett.netnet120720171
gumrukdanisma.comcom1324220170
umuttufan.comcom902820130
gunesliinsaat.comcom1301220181
temalibre.comcom901220181
halecusick.comcom1001520150
vitaminside.comcom110120170
dirlikinsaat.netnet1201020172
sevgikaraca.comcom1101720171
chelseaopera.comcom12281420161
dariaburkova.comcom125115820180
markcolliersite.comcom1512920080
forumfikir.comcom1061820181
redonkulis.comcom1051820170
resimlimobilya.comcom1401620180
kilichome.comcom90220180
yellowbaba.comcom100120180
golfplaza.orgorg910541201615
ankaragitar.comcom1101220180
yogizona.comcom80420180
cesurkepenk.comcom1101720180
keremtutuncu.comcom120120160
hayatgaziantep.comcom140820180
radarpena.comcom92289020132
jacksonholding.comcom1436020170
guangzhouyalin.comcom14222420180
gorakhpurmart.comcom1301020181
spotlamba.netnet90520181
sasafoto.comcom801120150
prairiemetal.netnet1201920111
meshurkofteci.comcom133320160
candanahsap.comcom1134820180
havenplanet.comcom110820180
hainanjin.comcom91120180
kirkalbertson.comcom1312720140
arasense.comcom80120171
onurstorperde.comcom1312820180
sinirturizm.comcom1102220140
ozelduvarsaati.comcom140120180
hepsinargile.comcom120120160
hangikaynak.comcom1111020180
adriamarti.comcom10343620111
jiaxinggeliwang.comcom150720180
reformhome.netnet101020182
yildizfatih.comcom110620180
golfstadium.comcom1102220150
albumhane.comcom90020180
inciperuk.comcom90420180
canandabel.comcom1013320120
ugurludag.comcom903620182
damarsarki.comcom1011682620170
barakajans.comcom10311120160
ellistudio.netnet10701820143
parsatak.comcom813120181
izmirtarim.comcom100520172
tenharengi.comcom100020170
tabletplan.comcom100220180
kenyonkaba.comcom10275620110
seasidemalta.comcom12779420170
lianhuagsi.comcom102020180
hostomaha.comcom904620110
grangerize.comcom100620182
firepainter.orgorg1121520131
kesanhalkekmek.comcom140120170
vitamincheck.netnet120020186
tedariklistesi.comcom140020180
studiomozaik.comcom1210420162
vitaminportal.netnet1301320167
martkolkata.comcom110020180
hemenbildir.comcom1101420180
alissalastres.comcom13243220150
ferisart.comcom8212020150
jupiterpass.comcom110120170
aslandamat.comcom100120170
minderbrand.comcom110720180
kartvizitmatbaa.comcom15212820182
monstermetro.comcom1201520170
duvallprinter.comcom130120170
ringborn.comcom80220180
salmatavuk.comcom1001320180
bellisimohome.comcom130220170
stepne.netnet60920181
hiddenzebra.comcom1102420180
buyukorhan.comcom1022120182
leagueplatform.comcom1401520160
mirasproject.comcom120120161
fotofarley.comcom101420130
beirutmodern.orgorg1201320050
bestpioneerbank.orgorg1501420071
fotodennis.orgorg100620135
ispartagenclik.orgorg1417782620111
policewall.orgorg1001320041
proteinturk.orgorg110720131
sapainca.orgorg822920113
acileczane.comcom1001520181
acilteknik.comcom100320180
adamclarkemedia.comcom150620130
adaptama.comcom80120180
ademturkoglu.comcom120620181
ankaradolapci.comcom1321120180
asiminsaat.comcom100720140
atashirt.comcom80220180
baliseyh.comcom801120182
beerstiens.comcom100720180
bolgetesisat.comcom124466720180
bonobani.comcom80020150
bricsloan.comcom90020180
bulutsozluk.comcom11205120130
conklinsales.comcom1201420090
dedeyaya.comcom8254220130
dixonmini.comcom90120130
dulcebebeperu.comcom130120140
emelghana.comcom95576220180
enginsarac.comcom1001020130
ensenadapoker.comcom130120170
esperantotalk.comcom130120140
failtime.comcom87920171
fatihacun.comcom95220180
fatihguzel.comcom1004520180
fidesave.comcom80020140
frankwaren.comcom1001220070
frerebebe.comcom90120080
gercus.comcom643520183
gibsonsmail.comcom1102320181
golfproper.comcom100120140
greenglobaltank.comcom150920100
gurunadam.comcom901620180
hangihali.comcom901220122
harbiinsaat.comcom1103120120
harptrap.comcom801020133
hemenfilo.comcom90120153
mariettavideo.comcom130920160
kahvecipasazade.comcom150220180
karibous.comcom80820180
kasadeal.comcom80020180
kocaaliguvenlik.comcom150320180
kucukbutikotel.comcom1401420180
kutukare.comcom827541320180
landonferguson.comcom140320170
lavagang.comcom80720180
leisureturizm.comcom130020180
lindimar.comcom82820130
lishuigolf.comcom100020120
noalevana.comcom90320160
marksbark.comcom91220181
masonsprings.comcom1201320072
matbaasistemi.comcom130120130
mavibiber.comcom90020090
forumchelsea.comcom125920160
grandhavenvideo.comcom150220160
searslinc.comcom912120160
searslink.comcom96120160
metriskitchen.comcom130120110
milwaukiekarate.comcom150120130
aromadoga.comcom90120160
caminome.comcom80220160
fatihveliolmez.comcom140420160
kekebeauty.comcom100620161
kuaforduygu.comcom110020160
martiniheist.comcom120220160
muzictempo.comcom1001020160
troyaman.netnet80020162
narmanambalaj.comcom1362020110
nedenboyle.comcom100920180
nemrutaksu.comcom100120150
barisicinherkes.orgorg150620161
formholding.orgorg110520162
bakirkoykuzey.comcom130120160
hilalmercedes.netnet130020161
yenisuriye.netnet100020160
yeninesilparti.orgorg140020160
oguzasik.comcom801020180
ormanclinton.comcom120120170
perubeaches.comcom1101320110
parahole.comcom80020161
villadiadema.comcom120120161
martmalaysia.comcom120020180
bathloopdizayn.comcom140120180
rolemana.comcom80120171
agrilist.netnet81126701020173
vitaminwissen.netnet130020163
primmost.comcom80020180
dijitaltacir.comcom120920180
stilyeri.comcom80020180
edirnemucadele.comcom1403820180
whitelabelpizza.comcom150120180
pacahills.comcom90220181
bursaholding.comcom120220180
energyspotters.comcom140220180
gangbazi.comcom80620181
citrusense.comcom100020180
logosfire.comcom90020180
serhatestate.comcom120220120
alexender.netnet90020182
sivricekoyu.comcom1118720181
sokakfilm.comcom913320180
paganhaven.netnet100020184
vitaminpartner.netnet140020153
sabaqatar.comcom913820180
zaferuygun.comcom100120170
linkexcel.netnet90020193
artistnorman.comcom120120170
bombayali.netnet90020170
abramedical.comcom110020170
mexicoindenmark.comcom150120170
perupati.netnet80020171
bankbani.comcom802820170
dinarbridge.comcom110220170
ganderlegal.comcom110120170
gustotango.comcom100120170
halvetroman.comcom110120170
insaatadair.comcom1101220170
kargotesisat.comcom120220170
kingsfordlegal.comcom141220170
likadiamond.comcom110120170
londonkars.comcom100220170
manybahtmanga.comcom1311120170
mutiaramesin.comcom121920170
myanmartitan.comcom120120170
novatester.comcom100120171
pardoporto.comcom100120170
sadagarden.comcom100120170
salvodent.comcom90120170
starhollowutah.comcom140120170
tanechoco.comcom90120170
vidaricaagora.comcom130120170
ebruengin.netnet90020171
hikayesine.netnet100020171
karaburton.netnet100020172
latinthunder.netnet120020171
libresquare.netnet110020172
amberburnett.orgorg120120171
armesgiyim.comcom100220170
aromahistrica.comcom130220170
mealvise.comcom80120170
midepizza.comcom92220170
roketegitim.orgorg110120171
taskingers.orgorg100120170
varlikdanismani.comcom150120170
vitaminoptimum.comcom140020170
tamabide.comcom80020170
revaniture.comcom100020170
belamayer.comcom901020170
finalnigeria.comcom120020170
hurdaalanankara.comcom1501420170
selenzorlumelik.comcom150220170
vitaminmedicine.netnet150020171
tarikaksu.netnet91020172
uyguntablo.comcom100920180
socialaris.comcom100120170
amazongardens.netnet130020171
selflens.comcom80020180
gazetemeydan.netnet120020081
willowsidepark.comcom141620150
transferburada.comcom140420180
yukiegitim.comcom100720180
ringdest.comcom80220180
ramseyprinter.comcom130220180
swindonstep.comcom110120181
pipodiamond.comcom110020140
primendeavor.comcom120120140
restoreontario.comcom140220130
robotsingapore.comcom140120100
romanerie.comcom90320052
selimkocamese.comcom130020130
spiritiste.comcom100220150
taponsuccess.comcom120120130
thomaserdem.comcom110020130
villapoyraz.comcom1101620090
villaviadana.comcom120020142
vittoriomagri.comcom130320150
yenidevre.comcom90020060
arcostar.netnet80220135
ashlandpark.netnet11111920032
bahcesaray.netnet10011200612
ozarknaturalist.netnet150020121
uruguaypunta.netnet120920101
starsalmanac.comcom120120180
mandacheng.comcom100320180
auracollegepark.comcom150120181
kayakingstar.comcom120020180
minemontauban.comcom130220180
naradubai.comcom90020180
bencildizi.comcom104620180
brillarasmoda.comcom130020180
edenboom.comcom81020180
egyptmuzic.comcom101020180
faizanandsamar.comcom141020180
penistock.comcom90020180
guvencevre.netnet100020181
neongolf.orgorg80020185
ademsaskin.comcom100020180
afisajans.comcom90020180
aslantahmin.comcom110020180
azorestore.comcom100020180
bestbitterbeer.comcom140020180
buddhamelon.comcom110020180
cihanmutfak.comcom110420180
custerhost.comcom100020180
evrymail.comcom80020180
fincenorg.comcom90020180
gunlukkefir.comcom110020180
havaliforum.comcom112020180
havuzgolet.comcom100020180
historiclagos.comcom130020180
hookmotor.comcom90020180
impianmumtaz.comcom120020180
keyfikefir.comcom100020180
kobraplast.comcom100520180
markcastellanos.comcom150020180
masalparkinsaat.comcom150620180
mikibank.comcom80020180
milletvalley.comcom120020180
mollatesisat.comcom120020180
mortonforum.comcom110020180
motorsaddle.comcom110020180
nancysiragusa.comcom130020180
paspasdergi.comcom110020180
platformbeacon.comcom140020180
ranature.comcom80020180
selenucak.comcom912020180
siestayapi.comcom100020180
siradisidoga.comcom120020180
sistemokul.comcom101356020180
sommerize.comcom90020180
startfirt.comcom955020180
tablopost.comcom90120180
taylorshakir.comcom120020180
tekinugurlu.comcom110220180
tropickart.comcom100020180
urbanbrooks.comcom110020180
veratercume.comcom110020180
wawasami.comcom80020180
woodgala.comcom80020180
yogaretreatbaja.comcom150020180
starringmedia.netnet130020182
liftprogress.orgorg120020185
tallapoosapres.orgorg140020180
aktifsorgulama.comcom140020180
ambarhonda.comcom100020180
castlesouk.comcom100020180
eliotsaat.comcom90020180
elliotsaat.comcom100020180
summerkarma.comcom110020180
grangerize.netnet100020182
rantmuch.netnet80020181
hartuniversity.orgorg140020181
stophecla.orgorg90020180
vigovideo.orgorg900201814
aharvali.comcom80020180
sophiaterzi.comcom110020180
eliotsaat.netnet90020180
elliotsaat.netnet100020180
rihtimhukuk.orgorg110020181
sekizpapel.orgorg100020180
albaniatransfer.comcom150020180
coinferma.netnet91020180
alexender.orgorg90020182
borayagi.comcom80020180
saimayuce.comcom90020180
destevin.comcom80020180
destevin.netnet80020180
teberboom.comcom90020180
tarifkazi.comcom90020180
otsukore.comcom80020180
adamedmonson.comcom120020180
daimakuang.comcom100020181
korekfire.comcom90020180
metrounik.comcom90020180
manymarket.netnet100020182
coinmarkettime.comcom140020180
altagamalaguna.comcom140020180
purobarcelona.comcom130020180
imaraffimugla.comcom130320180
imaraffiturkiye.comcom150020181
yapikayitmugla.comcom140020180
belmondbank.comcom110020180
wingkingsemail.comcom140020180
annekarl.comcom80020180
macagutierrez.comcom130020190
nabizturk.comcom90020190
orientkult.comcom100020160

Dün ve daha önceki günlerde düşen alan adlarını linkte bulabilirsiniz: Dün Düşen Domainler

Uzantı alan adlarını uzantı türüne göre bu bölümde görebilir ve tablo sıralamasını bu sütündan değiştirebilirsiniz. Eğer sadece COM uzantılı adresler ile ilgileniyorsanız aşağıdaki tabloda “Bul” kısmına “.COM” yazmanız halinde sadece bu uzantıya sahip adresleri görebilirsiniz. Sitemizde sadece önde gelen 3 uzantıya yer veriyoruz. Bu kısımda .NET ve .ORG uzantılarını da aynı yöntem ile listeleyebilirsiniz.

Uzunluk bu sütunda alan adlarını karakter sayısına göre küçükten büyüğe yada büyükten küçüğe doğru sıralandırabilirsiniz.

Backlink sayısı alan adının sahip olduğu toplam backlink sayısıdır. Maalesef internette düzgün çalışan API bulmak çok zor olduğu için bu verilerimiz güvenilir değildir. Eğer backlink değeri için alan adı alacaksanız lütfen kendiniz de adresi sorgulayınız. Tablomuzdaki veriler yüzde yüz doğru değildir bu sütunumuzda.

Archive sütununda adresin archive.org sitesinde yer alan kayıt sayısını görebilirsiniz. Domainin daha önce hangi kategorilerde ve aktif olarak yayın yapıp yapmadığına dair bu bölüm fikir vermektedir.

Son Kayıt sütununda adresin bilinen en eski kayıt tarihi yer almaktadır. Domainin geçmişi için önemli bir kriterdir.

Toplam Kayıt sütununda ise com, net, org gibi kaç farklı uzantısının kayıtlı olduğunu görebilirsiniz.


Satılık Alan Adları

Haftanı popüler webmaster forumları ve domain platformlarında devam eden açık arttırmaları ve hemen al fiyatlı satışlarını aşağıdaki listemizde bulabilirsiniz.

Listemiz sürekli güncellenecektir, alan adları ile ilgileniyorsanız lütfen yazımızı hafta boyunca takip edin !

Açık arttırmada olan alan adlarının isimlerine tıklayarak satışın yapıldığı sayfaya gidebilirsiniz.

İlgilendiğiniz Adresler İçin Linteki Bağlantıdan Bize Ulaşabilirsiniz: Domain Satış

DomainKategoriFirmaKayıtBitiş
hiyeroglif.comJenerikNameBright20162020
kofa.netCVCVGodaddy19982020
sosyaluzman.comWebmasterNamebright20182020
iletisim.orgGenelGodaddy20012020
kocaelihaber.orgHaberGodaddy20072020
ressam.netGenelGodaddy20022020
beyler.netGenelGodaddy20002020
firmalar.orgE-TicaretGodaddy20062020
guzelseo.comWebmasterGodaddy20192020
ucretsiztema.comWebmasterNamebright20192020
seoscore.netWebmasterGodaddy20172020
3dview.netWebmasterGodaddy20142020
idealnet.netWebmasterGodaddy19962020
adanaliyik.comGenelNamebright20152020
muhi.netCVCVHostingcomtr20192020
pezu.netCVCVNamesilo20192020
vohe.netCVCVHostingcomtr20192020
levu.netCVCVHostingcomtr20192020
kevu.netCVCVHostingcomtr20192020
luhi.netCVCVHostingcomtr20192020
gundem724.comHaberGodaddy20192020
mangir.netCoinHostgator20172019
izlenme.comE-TicaretGodaddy20192020
gorselarama.comGenelGodaddy20182019
gorselbilgi.comGenelGodaddy20192020
aranmahacmi.comWebmasterGodaddy20192020
bagcilar.coİlçeGodaddy20192020
gaziosmanpasa.coİlçeGodaddy20192020
sariyer.coİlçeGodaddy20192020
kagithane.coİlçeGodaddy20192020
catalca.coİlçeGodaddy20192020
buyukcekmece.coİlçeGodaddy20192020
gungoren.coİlçeGodaddy20192020